Научная статья на тему 'Дифференциация штаммов Yersinia pestis основного, неосновного подвидов и других представителей Yersinia pseudotuberculosis complex'

Дифференциация штаммов Yersinia pestis основного, неосновного подвидов и других представителей Yersinia pseudotuberculosis complex Текст научной статьи по специальности «Медицина и здравоохранение»

CC BY
31
5
Поделиться
Ключевые слова
YERSINIA PSEUDOTUBERCULOSIS / YERSINIA PESTIS / YERSINIA SIMILIS / ИДЕНТИФИКАЦИЯ / IDENTIFICATION / ЛАБОРАТОРНАЯ ДИАГНОСТИКА / LABORATORY DIAGNOSTICS / Y. SIMILIS

Аннотация научной статьи по медицине и здравоохранению, автор научной работы — Кисличкина Ангелина Александровна, Кадникова Л.А., Платонов М.Е., Майская Н.В., Коломбет Л.В., Соломенцев В.И., Богун А.Г., Анисимов А.П.

В составе вида Yersinia pestis различают два подвида основной (pestis) был причиной трех пандемий чумы, а штаммы неосновного подвида (microti), циркулируют, как правило, в популяциях различных видов полевок (Microtus spp.) и лишь некоторые из них вызывают у людей редкие эндемичные заболевания средней тяжести без дальнейшей передачи от человека человеку. Существование сопряженных очагов чумы с циркуляцией на одной территории нескольких генотипов, биоваров и даже обоих подвидов Y. pestis, а также периодический занос штаммов Y. pestis основного подвида в очаги, в которых раньше выделяли только полевочьи штаммы, требуют быстрого и надежного определения подвидовой принадлежности выделенных культур Y. pestis для оптимизации противоэпидемических мероприятий. Для дифференциации основного и неосновного подвидов Y. pestis между собой и с Y. pseudotuberculosis в настоящем исследовании проанализировали ДНК-мишени (YPDSF_3711 и opgG), подобрали праймеры, определили оптимальные концентрации компонентов реакционной смеси и выбрали температурный режим для проведения ПЦР. Разработанная тест-система по количеству и размерам ампликонов позволяет дифференцировать штаммы Y. pestis основного (563 пн), двух филогенетических групп неосновного подвида (генотипы 0.PE2, 0.PE3, 0.PE4 и 0.PE5 583 пн, 426 пн; генотип 0.PE7 779 пн, 515 пн, 358 пн), прародителя чумного микроба Y. pseudotuberculosis (779 пн, 583 пн, 426 пн) и близкородственного вида Y. similis (779 пн, 426 пн). Исследования, проведенные на представительной выборке штаммов из коллекции «ГКПМ-Оболенск» (http://obolensk.org/center/state-collection.htm) и нуклеотидных последовательностях, депонированных в DDBJ/EMBL/GenBank, показали 100% специфичность и чувствительность предлагаемого метода.

Похожие темы научных работ по медицине и здравоохранению , автор научной работы — Кисличкина Ангелина Александровна, Кадникова Л.А., Платонов М.Е., Майская Н.В., Коломбет Л.В., Соломенцев В.И., Богун А.Г., Анисимов А.П.,

Не можете найти то, что вам нужно? Попробуйте наш сервис подбора литературы.

Текст научной работы на тему «Дифференциация штаммов Yersinia pestis основного, неосновного подвидов и других представителей Yersinia pseudotuberculosis complex»

ОРИГИНАЛЬНЫЕ СТАТЬИ

© КОЛЛЕКТИВ АВТОРОВ, 2017 УДК 579.842.23:579.253.2].083.1

Кисличкина А.А., Кадникова Л.А., Платонов М.Е., Майская Н.В., Коломбет Л.В., Соломенцев В.И., Богун А.Г., Анисимов А.П.

дифференциация штаммов YERSINIA PESTIS основного, неосновного подвидов и других представителей YERSINIA PSEUDOTUBERCULOSIS

complex

Государственный научный центр прикладной микробиологии и биотехнологии Роспотребнадзора, 142279, Московская обл.,

Серпуховский р-н, п. Оболенск

В составе вида Yersiniapestis различают два подвида - основной (pestis) был причиной трех пандемий чумы, а штаммы неосновного подвида (microti), циркулируют, как правило, в популяциях различных видов полевок (Microtus spp.) и лишь некоторые из них вызывают у людей редкие эндемичные заболевания средней тяжести без дальнейшей передачи от человека человеку. Существование сопряженных очагов чумы с циркуляцией на одной территории нескольких генотипов, биоваров и даже обоих подвидов Y. pestis, а также периодический занос штаммов Y. pestis основного подвида в очаги, в которых раньше выделяли только полевочьи штаммы, требуют быстрого и надежного определения подвидовой принадлежности выделенных культур Y. pestis для оптимизации противоэпидемических мероприятий. Для дифференциации основного и неосновного подвидов Y. pestis между собой и с Y. pseudotuberculosis в настоящем исследовании проанализировали ДНК-мишени (YPDSF_3711 и opgG), подобрали праймеры, определили оптимальные концентрации компонентов реакционной смеси и выбрали температурный режим для проведения ПЦР. Разработанная тест-система по количеству и размерам ампликонов позволяет дифференцировать штаммы Y. pestis основного (563 пн), двух филогенетических групп неосновного подвида (генотипы 0.PE2, 0.PE3, 0.PE4 и 0.PE5 - 583 пн, 426 пн; генотип 0.PE7 - 779 пн, 515 пн, 358 пн), прародителя чумного микроба - Y. pseudotuberculosis (779 пн, 583 пн, 426 пн) и близкородственного вида Y. similis (779 пн, 426 пн). Исследования, проведенные на представительной выборке штаммов из коллекции «ГКПМ-Оболенск» (http://obolensk.org/ center/state-collection.htm) и нуклеотидных последовательностях, депонированных в DDBJ/EMBL/GenBank, показали 100% специфичность и чувствительность предлагаемого метода. Ключевые слова: Yersinia pseudotuberculosis; Yersinia pestis; Yersinia similis; идентификация; лабораторная диагностика.

Для цитирования: Кисличкина А.А., Кадникова Л.А., Платонов М.Е., Майская Н.В., Коломбет Л.В., Соломенцев В.И., Богун А.Г., Анисимов А.П.Дифференциация штаммов Yersinia pestis основного, неосновного подвидов и других представителей Yersinia pseudotuberculosis complex. Молекулярная генетика, микробиология и вирусология. 2017; 35 (2): 43-48. DOI 10.18821/02080613-2017-35-2-43-48

Возбудитель чумы - Yersinia pestis - дивергировал от Y. pseudotuberculosis всего 5-7 тыс. лет назад [1], превратившись из энтеропатогенной бактерии с фекально-оральным путем передачи в возбудителя генерализованной септической инфекции - чумы, передающейся кровососущими насекомыми - блохами. Видообразование сопровождалось целым комплексом изменений генома, основными из которых были приобретение (путем горизонтального переноса) нового генетического материала, включая плазмиды pFra и рР1а, и утрата функций более 100 генов в процессе адаптации возбудителя к новым условиям существования за счет образования инсерций и делеций, перестройки IS-элементов [2].

Для корреспонденции: Кисличкина Ангелина Александровна; e-mail - kislichkina@obolensk.org

Микроэволюция приспособила отдельные внутривидовые группы Y. pestis к циркуляции в популяциях более 200 видов грызунов или зайцеобразных [3, 4]. Представители этих филогенетических групп чумного микроба различаются по своим фенотипам и генотипам, что позволило разделить вид на два подвида - основной (subsp. pestis) и неосновной (subsp. microti), каждый из которых включает по несколько биоваров [5]. Бактерии основного подвида были причиной трех пандемий чумы, унесших более 200 млн человеческих жизней, а -неосновного, циркулирующие в популяциях различных видов полевок (Microtus spp.), вызывают у людей редкие эндемичные заболевания, не передающиеся от человека человеку [6]. Соответственно, эпидемический потенциал (опасность заражения людей)1 у природных очагов чумы полевочьего типа существенно ниже, что даже послужило в 1998-2008 гг. основанием для значительного снижения в них «в условиях ограниченных финансовых и материально технических ресурсов» объемов дорогостоящего эпизоотологического обследования2. Однако существование сопряженных очагов чумы с циркуляцией на одной и той же территории нескольких генотипов, биоваров и даже обоих подвидов Y. pestis [7, 8], а также периодический занос штаммов Y. pestis основного подвида в очаги, в которых раньше выделяли только штаммы неосновного подвида [9], требуют быстрого и надежного определения подвидовой принадлежности эпизоотически активных штаммов для оптимизации противоэпидемических мероприятий. Недавно была описана и даже включена в «Стандартный алгоритм молекулярного типирования штаммов Y. pestis» ПЦР тест-система, позволяющая в короткое время идентифицировать подвидовую принадлежность исследуемого изолята [10]. Однако эту тест-систему разработали и оценивали только на наборе штаммов, представляющих природные очаги стран СНГ, что не гарантирует эффективность ее работы по дифференциации изолятов из других регионов, так как в ходе микроэволюции чумного микроба возможна утрата фрагментов генома, используемых в качестве диагностических мишеней. Так, область 3а в хромосоме Y. pestis была рекомендована в качестве маркера для быстрого обнаружения и идентификации возбудителя чумы методом ПЦР. Но недавно на территории

Юрганизация и проведение эпидемиологического надзора в природных очагах чумы на территории Российской Федерации. МУ 3.1.3.2355-08. М.; 2009.

2Временные методические указания по организации и проведению эпидемиологического надзора в природных очагах чумы России в условиях ограниченных финансовых и материально технических ресурсов. МУ 3.1.700-98.

SNP-тип/биовар

Северного Китая выделены 15 штаммов, потерявших хромосомный участок, содержащий 3а область [11].

Не можете найти то, что вам нужно? Попробуйте наш сервис подбора литературы.

Кроме того, индикация, направленная на одну специфическую для патогена мишень, не исключает ложнопо-ложительных результатов. Так, на протяжении многих лет в диагностической практике использовали «видо-специфический» ген pla или его продукт - активатор плазминогена, но недавно были опубликованы данные о наличии гомологичных pla участков ДНК у представителей Citrobacter koseri, Escherichia coli [12, 13] и даже у млекопитающих [14]. Очевидно, что использование нескольких независимых молекулярных мишеней позволит повысить как чувствительность, так и специфичность лабораторной диагностики.

В настоящей работе предложена альтернативная тест-система для детекции и дифференциации основного и неосновного подвидов Y. pestis между собой и с другими представителями Y. pseudotuberculosis complex.

Материал и методы

Бактериальные штаммы. В работе использовали набор из 51 штамма Y. pestis основного и неосновного подвидов из природных очагов чумы Российской Федерации, ближнего и дальнего зарубежья (табл. 1) и 6 штаммов Y. pseudotuberculosis различных сероваров (О:1с, О:1Ь, О:2с, О:3, О:4а, О:4с). Все штаммы получены из Государственной коллекции патогенных микроорганизмов и клеточных культур «ГКПМ-Оболенск».

Бактерии выращивали на агаре Хоттингера с добавлением 1% гемоли-зированной крови в течение 48 ч при температуре 28°С. Геномную ДНК выделяли, как описано ранее [15].

Полногеномные последовательности штаммов Yersinia. В работе использовали полногеномные последовательности 59 штаммов Y. pestis из базы данных DDBJ/EMBL/ GenBank (табл. 2), 19 из которых определены нами ранее [16], а также аналогичные данные о Y. pseudotu-berculosis IP32953 (CP009712.1) и Y. similis 228 (CP007230.1).

Для анализа полногеномных ну-клеотидных последовательностей представителей различных филогенетических групп Y. pestis использовали программы NCBI Genome (http://www. ncbi.nlm.nih.gov/), BLAST (Basic Local Alignment Search Tool; http://www. ncbi.nlm.nih.gov/BLAST/), Mauve -Multiple Genome Alignment (http://gel. ahabs.wisc.edu/mauve/), Lasergene 11 (DNASTAR, USA). Для выравнивания нуклеотидных и аминокислотных последовательностей использовали программу MAFFT 7 (http://maiit.cbrc.jp/ alignment/server/index.html).

Дифференциация штаммов

Y. pestis и остальных представителей Y. pseudotuberculosis complex. В качестве мишени для дифференциации штаммов Y. pestis и Y. pseudotuber-culosis complex выбрали ген opgG, утраченный в ходе видообразования чумного микроба [17]. На основе этого гена разработали олигонуклео-тидные праймеры opgG_for 5' CGTT-

Таблица 1 Использованные в работе штаммы Y. pestis и Y. pseudotuberculosis

Характеристика штаммов

Количество штаммов

Y. pseudotuberculosis 0:1c

Y pseudotuberculosis 0:1b

Y pseudotuberculosis 0:2c

Не можете найти то, что вам нужно? Попробуйте наш сервис подбора литературы.

Y pseudotuberculosis 0:3

Y pseudotuberculosis 0:4a

Y pseudotuberculosis 0:4c

Y pestis subsp. pestis bv. orientalis l.ORI

Y pestis subsp. pestis bv. medievalis 2.MED

Y pestis subsp. pestis bv. antiqua ?ANT*

Y pestis subsp. microti bv. caucasica 0.PE2

Y pestis subsp. microti bv. hissarica 0.PE4

Y pestis subsp. microti bv. talassica 0.PE4

Y pestis subsp. microti bv. altaica 0.PE4

Y pestis subsp. microti bv. xilingolensis 0.PE4

Y pestis subsp. microti bv. ulegeica 0.PE5

8

5 4 14 1 3

6 1 3

Не можете найти то, что вам нужно? Попробуйте наш сервис подбора литературы.

* - SNP-тип [8] штаммов не определен, принадлежность к биовару определяли по фенотипическим признакам.

Таблица 2

Использованные в работе полногеномные последовательности штаммов Y pestis

Коды доступа

Количество штаммов

subsp. microti

0.PE2 / caucasica ADSG00000000 LIYU00000000 LIZB00000000 13

LIYP00000000 LIYX00000000 LIZC00000000

LIYQ00000000 LIYY00000000 LIZE00000000

CP000668.1 LIYZ00000000 LIZF00000000

CP010247.1

0.PE3/angola CP000901.1 1

0.PE4/altaica, AD0V00000000 ADPT00000000 LIYT00000000 15

talassica, ADRT00000000 ADST00000000 LIYV00000000

hissarica, NZ_ACNT0000000 ADRM00000000 LIZA00000000

Не можете найти то, что вам нужно? Попробуйте наш сервис подбора литературы.

xilingolensis, ADQ000000000 LIYW00000000 LIYR00000000

qinghaiensis AE017042.1 CP010023.1 LIYS00000000

0.PE5 / ulegeica LIY000000000 LIZG00000000 LIZD00000000 3

0.PE7 ADQE00000000 ADPM00000000 2

subsp. pestis

0.ANT/antiqua ADPG00000000 ADRD00000000 ADQU00000000 9

ADQW00000000 ADPJ00000000 ADPX00000000

ADPV00000000 ADQV00000000 ADPH00000000

1.ANT/antiqua NZ_AAYR00000000 CP009906.1 2

2.ANT/antiqua CP000305.1 AD0X00000000 ADSF00000000 3

3.ANT/antiqua ADRC00000000 ADSW00000000 2

4.ANT/antiqua ADSV00000000 1

2.MED/ medievalis ADPA00000000 ADRQ00000000 AE009952.1 3

1.IN/intermedium ADQK00000000 ADPK00000000 2

1.0RI/orientalis ADSB00000000 44 ADSA00000000 CP009973.1 3

Не можете найти то, что вам нужно? Попробуйте наш сервис подбора литературы.

CLUSTAL format alignment by MAFFT (v7.306b)

Y. pestis C092 AJJ87387.1 Y. pestis Pest. F ABP42061.1 Y.pstblP 32953 AJJ55767.1

ДЕЛЕЦИЯ

I-1

-----------------------------MIADEQASASAFANSAITSILCYPIDLFPIY

MKSIQFILFRQEGVLRSDGERYVIPAGKLVIADEQASASAFANSAITSILCYPIDLFPIY MKSIQFILFRQEGVLRSDGERYVIPAGKLVIADEQASASAFANSAITSILCYPIDLFPIY

. ******************************

Y. pestis C092 AJJS7387.1 Y. pestis Pest. F ABP42061.1 Y.pstblP 32953 AJJ55767.1

QDLARRTLPLNKGHLPHAVNDKYKVLPANVEIIQAAEELINIERVASLRFLYLYCLGIDN QDLARRTLPLNKGHLPHAVNDKYKVLPANVEIIQAAEELINIERVASLRFLYLYCLGIDN

QDLARRTLPLNKGHLPHAVNDKYKVLPANVEIIQAAEELINIERVASLRFLYLYCLGIDN ************************************************************

Y. pestis C092 AJJ87387.1 Y. pestis Pest. F ABP42061.1 Y.pstblP 32953 AJJ55767 .1

VYFSKLLDSIVGTNWELLEFFEKNRLNPWSVSRYANELGISTRKLNFLFYEKFGMSAKQW VYFSKLLDSIVGTNNELLEFFEKNRLNPWSVSRYANELGISTRKLNFLFYEKFGMSAKQW

VYFSKLLDSIVGTNNELLEFFEKNRLNPWSVSRYANELGISTRKLNFLFYEKFGMSAKQW ************************************************************

Y. pestis C092 AJJ87387.1 Y. pestis Pest. F ABP42061.1 Y.pstblP 32953 AJJ55767 .1

LLDQRLKKGCELLLSTRLRVADIAMECGFSNHAHFSDSFRRRFQQCPSHMRSLIE LLDQRLKKGCELLLSTRLRVADIAMECGFSNHAHFSDSFRRRFQQCPSHMRSLIE

Не можете найти то, что вам нужно? Попробуйте наш сервис подбора литературы.

LLDQRLKKGCELLLSTRLRVADIAMECGFSNHAHFSDSFRRRFQQCPSHMRSLIE *******************************************************

Рис. 1. Выравнивание аминокислотных последовательностей белков AJJ87387.1, ABP42061.1 и AJJ55767.1 штаммов Y. pestis C092, Y. pestis Pestoides F и Y. pseudotuberculosis IP 32953. Схематично указано место, которому соответствует делеция в геноме штаммов

Y. pestis основного подвида.

GAGCGCAATGTCTGTT 3' и opgG_rev 5' GTATGCTCG-GTGCCAGCTA 3'.

Поиск ДНК-мишени для дифференциации штаммов основного и неосновного подвидов Y. pestis. С помощью алгоритма BLAST провели выравнивание геномов девяти штаммов Y pestis, в том числе четырех изолятов основного подвида: Antiqua (bv. antiqua, 1.ANT), Nepa1516 (bv. antiqua, 2.ANT), KIM10+ (bv. medievalis, 2.MED), C092 (bv. orientalis, 1.0RI) и пяти полевочьих штаммов: Pestoides F (bv. caucasica, 0.PE2), Pestoides G (bv. caucasica, 0.PE2), Angola (bv. angola, 0.PE3), Pestoides B (bv. altaica, 0.PE4), 91001 (bv. xilingolensis, 0.PE4), и штамма Y. pseudotuberculosis IP32953 - (0:1b серовар), полные нуклео-тидные последовательности которых представлены в базе данных DDBJ/EMBL/GenBank. В результате в гене YPDSF3711 (Y. pestis Pestoides F) выявлена делеция (20 пн), характерная для штаммов Y. pestis подвида pestis. Ген YPDSF3711 кодирует белок, относящийся к семейству AraC регуляторов транскрипции и расположен в кластере генов, кодирующих одну из систем секреции III типа чумного микроба. Делеция привела к сдвигу в рамке считывания и возможности образования только более короткого белка у штаммов Y. pestis подвида pestis (206 &о.): Antiqua (AJJ81523.1), C092 (AJJ87387.1), KIM10+ (AAM84106.1) и Nepal516 (ABG19736.1). Полноразмерный белок (235 a^.) присутствует у Y. pseudotuberculosis IP 32953 (AJJ55767.1), Y. similis 228 (AHK19541.1) и у штаммов Y. pestis неосновного подвида: Pestoides F (ABP42061.1), Pestoides B (AJK10554.1), Pestoides G (AJK22696.1), Angola (ABX87008.1) и 91001 (AAS60684.1) (рис. 1).

Сконструировали олигонуклеотидные праймеры, фланкирующие делецию в гене YPDSF3711 - T3SS_1_ for (5' CTGACGTTGCGCTATGGGA 3') и T3SS_rev_1 5' CCATGGGTTGAGCCGATTCT 3'. Второй прямой праймер T3SS_2_for (5' TATTTCGGCAAGAGGGCGTA 3) сконструировали на основе последовательности де-леции (рис. 2).

Валидация условий ПЦР.

Подобрали оптимальный состав реакционной смеси для проведения ПЦР: 10* буфер для ПЦР (15 мМ MgCl2), 0,15 мМ каждого дНТФ, по 1 мкМ праймеров opgG_for, opgG_rev, T3SS_1_for 1 и T3SS_rev_1, 0,15 мкМ праймера T3SS_2_for, 1,5 ед Taq-полимеразы, образец ДНК - 10-20 нг; деионизованная вода до 25 мкл в расчете на одну пробу. В результате проведенных экспериментов определили температурные и временные условия, необходимые для проведения ПЦР Использовали следующий режим амплификации: начальная денатурация - 95°С/3 мин; затем 30 циклов, состоящих из денатурации 95°С/30 с, отжига 55°С/30 с и элонгации 72°С/40 с, завершающий цикл 5 мин 30 с - 72°С. Результаты учитывали методом электрофореза в 2% агарозном геле при окрашивании бромистым этидием с применением маркеров размеров ДНК «0'RangeRuler 50 bp DNA Ladder» («Fermentas», Литва).

Результаты и обсуждение

Оценка эффективности использования выбранных ДНК-мишеней для дифференциации in silico штаммов основного и неосновного подвидов Y. pestis между собой и с остальными представителями Y. pseudotuberculosis complex.

С целью подтверждения пригодности выбранных ДНК-мишеней (YPDSF_3711 и opgG) для дифференциации штаммов основного и неосновного подвидов Y. pestis и других представителей Y. pseudotuberculosis complex проанализировали полногеномные последовательности штаммов Y. pestis различных филогенетических групп, размещенные в базе данных DDBJ/EMBL/ GenBank (табл. 3).

Из табл. 3 видно, что у штаммов чумного микроба SNP-типов 0.ANT, 1.ANT, 2.ANT, 3.ANT, 4.ANT, 2.MED,1.IN, 1.0RI имеется делеция протяженностью 20 пн; у 0.PE2-0.PE5 штаммов - ген полноразмерный; а у представителей наиболее древней филогенетической

CLUSTAL format alignment by MAFFT (v7.306b) T3SS_l_for

Y_pstb_IP_3 29 53 tdctqacqttqcqctatqqqahtaaaqaataaaqtqatqtttactqtctqattattcaqa Y_pest_pest_F tactgacgttgcgctatgggaataaagaatgaagtgatgtttactgtctgattattcaga Y_pest_C092 tactgacgttgcgctatgggaataaagaatgaagtgatgtttactgtctgattattcaga Y_pest_0_PE7 tactgacgttgcgctatgggaataaagaatgaagtgatgtttactgtctgattattcaga

Y_pstb_IP_32953 cttcaggtgaataccggatacgcattggcagtattattggtcaaactgcataagattaat

Не можете найти то, что вам нужно? Попробуйте наш сервис подбора литературы.

Y_pest_pest_F cttcaggtgaataccggatacgcattggcagtattattggtcaaactgcataagattaat

Y_pest_C092 cttcaggtgaataccggatacgcattggcagtattattggtcaaactgcataagattaat

Y_pest_G_PE7 cttcaggtgaataccggatacgcattggcagtattattggtcaaactgcataagattaat

I T3SS_2_for_

Y_pstb_IP_32953 tgttccctaaggaatatcatgaagtcaatacagtttatttfcatttcggcaagagggcgta| Y_pest_pest_F tgttccctaaggaatatcatgaagtcaatacagtttattttatttcggcaagagggcgta

Y_pest_C09 2 tgttccctaaggaatatcatgaagtcaatacagtttat--------------------ta

Y_pest__0_PE7 tgttccctaaggaatatcatgaagtcaatacagtttattttatttcggcaagagggcgta

Y_pstb_Ip_32953 ttacgcagtgatggcgagcgctatgttatacctgcgggaaaattagtgattgccgatgag

Y_pest_Pest_F ttacgcagtgatggcgagcgctatgttatacctgcgggaaaattagtgattgccgatgag

Y_pest_C092 ttacgcagtgatggcgagcgctatgttatacctgcgggaaaattagtgattgccgatgag

Y_pest_0_PE7 ttacgcagtgatggcgagcgctatgttatacctgcgggaaaattagtgattgccgatgag

Y_pstb_IP_32953 caggccagtgcctctgcgtttgcaaacagtgccatcacctctatattatgttacccaata

Y_pest_pest_F caggccagtgcctctgcgtttgcaaacagtgccatcacctctatattatgttacccaata

Y_pest_C092 caggccagtgcctctgcgtttgcaaacagtgccatcacctctatattatgttacccaata

Y_pest_0_PE7 caggccagtgcctctgcgtttgcaaacagtgccatcacctctatattatgttacccaata

Не можете найти то, что вам нужно? Попробуйте наш сервис подбора литературы.

Y_pstb_IP_3 2953 gatctttttccgatatatcaggatttagccagaagaacattaccgttgaataaaggccat

Y_pest_pest_F gatctttttccgatatatcaggatttagccagaagaacattaccgttgaataaaggccat

Y_pest_C09 2 gatctttttccgatatatcaggatttagccagaagaacattaccgttgaataaaggccat

Y_pest_0_PE7 gatctttttccgatatatcaggattta---------------------------------

Y_pstb_IP_32953 cttcctcatgcggtaaatgataaatataaagtgttgccagcgaatgttgaaattatacaa

Y_pest_Pest_F cttcctcatgcggtaaatgataaatataaagtgttgccagcgaatgttgaaattatacaa

Y_pest_C092 cttcctcatgcggtaaatgataaatataaagtgttgccagcgaatgttgaaattatacaa

Y_pest_0_PE7 -----------------------------------gccagcgaatgttgaaattatacaa

Y_pstb_IP_32953 gctgctgaagaattaattaatatagagcgtgttgcctctctgcgatttctttatctttat

Y_pest_pest_F gccgctgaagaattaattaatatagagcgtgttgcctctttgcgatttctttatctttat

Y_pest_c09 2 gccqctgaagaattaattaatatagagcgtgttgcctctttgcgatttctttatctttat

Y_pest_0_PE7 gccgctgaagaattaattaatatagagcgtgttgcctctttgcgatttctttatctttat

Y_pstb_IP_3 2953 tgtttaggtatcgataacgtttatttttccaagctgttggactccattgtgggtacgaat

Y_pest_pest_F tgtttaggtatcgataacgtttatttttccaagctgttggactccattgtgggtacgaat

Y_pest_C09 2 tgtttaggtatcgataacgtttatttttccaagctgttggactccattgtgggtacgaat

Не можете найти то, что вам нужно? Попробуйте наш сервис подбора литературы.

Y_pest_0_PE7 tgtttaggtatcgataacgtttatttttccaagctgttggactccattgtgggtacgaat

_T3SS_rev_l

Y_pstb_IP_3 29 53 aarnaartartt.nantt.tttrnaaJqnaatrnfictraarrrat-.nnkiTfntttcarnct.at Y_pest_Pest_F aacgaactacttgagtttttcgaaaagaatcggctcaacccatggagcgtttcacgctat Y_pest_C09 2 aacgaactacttgagtttttcgaaaagaatcggctcaacccatggagcgtttcacgctat Y_pest_0_PE7 aacgaactacttgagtttttcgaaaagaatcqgctcaacccatggagcgtttcacgctat

Рис. 2. Выравнивание нуклеотидных последовательностей штаммов Y. pestis (Y. pestis C092, Y. pestis 0.PE7 и Y. pestis Pestoides F) и Y. pseudotuberculosis (Y. pseudotuberculosis IP32953). Показано положение праймеров (T3SS_1_for, T3SS_ rev_1, T3sS_2_for). Стрелками схематично указаны стартовые кодоны AJJ87387.1 - Y. pestis C092, AJJ55767.1 -Y. pseudotuberculosis IP 32953.

Выбранные ДНК-мишени проверили на специфичность с использованием алгоритма BLAST. В первую очередь проанализировали нуклеотидную последовательность штамма Y. similis 228 (CP007230.1) - ближайшего генетического родственника Y. pestis и Y. pseudotuberculosis, высказывались предложения объединить эти виды на основании данных гомологии ДНК и биохимического сходства в Y. pseudotuberculosis complex [18]. Исходя из нуклеотидной последовательности генома Y. similis 228, размещенной в NCBI Genome пара праймеров T3SS_2_for и T3SS_rev_1 будут образовывать фрагмент амплификации, в то время как праймер T3SS_1_for содержит три неспаренности и работать не будет, а праймеры opgG_for и opgG_rev будут образовывать фрагмент амплификации.

Праймеры (T3SS_1_for, T3SS_rev_1, T3SS_2_for), выбранные для дифференциации штаммов основного и неосновного подвидов Y. pestis между собой и с Y. pseudotuberculosis не комплементарны нуклеотид-ным последовательностям других представителей рода Yersinia - Y. aldovae, Y. aleksiciae, Y. enterocolitica, Y. en-tomophaga, Y. frederiksenii, Y. intermedia, Y. kristensenii, Y. rohdei, Y. ruckeri. Y. bercovieri, Y. massiliensis, Y. mol-laretii. В процессе ПЦР с праймерами opgG_for и opgG_ rev могут образовываться специфичные амплификаты (779 п.н.) с ДНК некоторых представителей рода Yersinia.

Разработанную тест-систему проверили в «классических экспериментах за лабораторным столом» на 51 штамме иерсиний (6 - Y. pseudotuberculosis, 17 - Y. pestis основного и 28 - неосновного подвида), что показало 100 % специфичность и чувствительность предложенного метода. Пример идентификации штаммов показан на рис. 3.

Чумной микроб, один из клонов возбудителя преимущественно кишечной инфекции - псевдотуберкулеза, успешно освоил новую экологическую нишу, превратившись в возбудителя генерализованного септического заболевания, передающегося кровососущими насекомыми, и сформировал природные очаги чумы на всех континентах кроме Австралии и Антарктиды. Как и у других, относительно «молодых» видов «генетически мономорф-ных» патогенных бактерий, пангеном Y. pestis содержит очень мало полиморфных участков, что характерно для клоновых родословных [19]. В ходе адаптации к широкому спектру паразитоценозов различных природных очагов популяция Y. pestis разделилась на несколько эко-типов (биоваров) в составе двух подвидов. Полевочьи штаммы подвида microti, лишь некоторые из которых вызывают у людей редкие эндемичные заболевания средней тяжести без дальнейшей передачи от человека человеку, циркулируют в природных очагах, расположенных в Евразии [5, 8], недалеко от предполагаемого места видообразования [8]. По результатам SNP-типирования к этой категории штаммов относятся и два музейных штамма SNP-типа 0.PE7, выделенные еще в начале шестидесятых годов от больного бубонной формой чумы человека и сибирского тушканчика (Allactaga sibirica) в природ-

группы Y. pestis 0.PE7 в исследуемом гене обнаружили более протяженную делецию - 68 пн. Кроме этого, у 0.PE7 штаммов присутствовал ген opgG, свойственный Y. pseudotuberculosis и Y. similis, но отсутствующий у других представителей вида Y. pestis.

В результате «ПЦР in silico» у штаммов Y. pseudotuberculosis и SNP-типа Y. pestis 0.PE7 «образовывалось» по три продукта амплификации, у остальных штаммов неосновного подвида Y. pestis - два продукта амплификации, а у штаммов Y. pestis основного подвида - один продукт амплификации (см. табл. 3).

Рис. 3. Электрофореграмма продуктов амплификации. 1-2 - Y. pseudotuberculosis, 3-4 - Y. pestis неосновного подвида (0.PE2-0. PE5), 5 - маркер молекулярной массы, 6-7 - Y. pestis основного подвида, 8 - отрицательный контроль амплификации.

Таблица 3

Анализ полногеномных последовательностей штаммов Y. pseudotuberculosis complex и Y. pestis на присутствие аллелей ДНК-мишеней

SNP-тип

Количество изученных геномов

Не можете найти то, что вам нужно? Попробуйте наш сервис подбора литературы.

Амплификаты генов (п.н.)

YPDSF 3711

opgG

MRCA*

0.PE7 0.PE2 0.PE3 0.PE4 0.PE5

0.ANT

1.ANT

2.ANT

3.ANT

4.ANT 2.MED 1.IN 1.0RI

Y. pseudotuberculosis IP32953

1 583, 42б

Y. similis 228

1 42б Y. pestis subsp. microti

2 515, 358 12 583, 42б 1

Не можете найти то, что вам нужно? Попробуйте наш сервис подбора литературы.

15

3

Y. pestis subsp. pestis 9 5б3

2 3 2 1 3 2 3

779

779

779

Примечание. * - наиболее близкий общий предок (most recent common ancestor).

ном очаге «C», расположенном в районе Синхай (Xing-hai district) китайской провинции Цинхай (Qinghai province). Изоляты из этого очага характеризуются большим разнообразием (SNP ветви 0, 1, 2 и 3 с преобладанием генотипа 1.IN). Основной хозяин - гималайский сурок (Marmota himalayana). По фенотипическим признакам оба штамма принадлежали к bv. antiqua [8]. Так, в отличие от других представителей геногруппы 0.PE, они не ферментировали рамнозу, что сближает их с «рамнозо-негативными» штаммами основного подвида.

В основной подвид pestis входят высоковирулентные для человека штаммы, послужившие причиной трех пандемий и сформировавшие в ходе этих пандемий природные очаги чумы по всему миру. Отличия в степени патогенности между штаммами двух подвидов, а также между отдельными изолятами внутри подвидов и даже биоваров требуют различных объемов противоэпидемических мероприятий в случае выявления больного и/ или выделения чистой культуры. Наличие в свободном доступе 277 в различной степени собранных и аннотированных геномов Y. pestis давало надежду на беспроблемное выявление методами сравнительной геноми-ки факторов избирательной вирулентности (хозяйской специфичности), но кодирующие их гены до сих пор не выявлены.

Мы решили упростить задачу и использовать в качестве молекулярной диагностической мишени не сами факторы хозяйской специфичности, а коррелирующие с ними маркеры.

Для конструирования нашей тест-системы гены-мишени (opgG и YPDSF 3711) отобрали на выборке полногеномных последовательностей представителей

различных филогенетических групп Y pestis. Затем подобрали праймеры, определили оптимальные концентрации компонентов реакционной смеси и выбрали температурный режим для проведения ПЦР. Расчеты «in silico» и «эксперименты за рабочим столом» свидетельствуют, что разработанная тест-система позволяет дифференцировать по количеству и размерам ампликонов штаммы Y. pestis основного (563 пн), двух филогенетических групп неосновного подвида (генотип 0.PE7 — 779 пн, 515 пн, 358 пн; генотипы 0.PE2, 0.PE3, 0.PE4 и 0.PE5 - 583 пн, 426 пн) и прародителя чумного микроба - Y. pseudotuberculosis (779 пн, 583 пн, 426 пн).

Следует отметить, что количество и размер ампли-конов ДНК-мишеней, свойственный наиболее близкому общему предку современных штаммов чумного микроба, Y pseudotuberculosis серовара 0:1b, были характерны и для всех других исследованных нами патогенных для человека сероваров (0:1c, 0:2c, 0:3, 0:4a, 0:4c). Исследования, проведенные на представительной выборке штаммов из коллекции «ГКПМ-0боленск» и нуклеотидных последовательностях, депонированных в DDBJ/EMBL/ GenBank, показали 100 % специфичность и чувствительность предлагаемого метода. С учетом постоянного роста количества доступных полногеномных последовательностей штаммов Y. pestis и ограничений на международный обмен высоко патогенными микроорганизмами, именно пригодность выбранных нами ДНК-мишеней для анализа данных массированного параллельного секвенирования является одним из существенных преимуществ перед описанным в «Стандартном алгоритме молекулярного типирования штаммов Y. pestis» прототипом [10], в котором для дифференциации штаммов Y. pestis и Y pseudotuberculosis используют наличие/отсутствие вставки IS 1541 в гене inv. С помощью метода полимеразной цепной реакции подобные вставки достаточно легко обнаружить за лабораторным столом, однако извлечь информацию о структуре подобных локусов из данных, полученных при использовании технологии массированного параллельного секвенирования, проблематично. Инсерционные элементы обладают высокой гомологией и представлены в геноме несколькими копиями [20], вследствие этого при биоинформационном анализе они не включаются в последовательности контигов. Это, в свою очередь, означает, что использовать ДНК-мишени из прототипного метода можно лишь при анализе полностью собранных геномов, составляющих меньшую часть из представленных в DDBJ/EMBL/GenBank.

Еще одним преимуществом нашей методики можно считать легкую интерпретацию результатов: штаммам Y. pestis основного подвида соответствует один продукт амплификации, штаммам неосновного подвида - два продукта, а прародителю чумного микроба Y pseudotubercu-losis и древнему генотипу 0.PE7 - по три продукта амплификации, отличающихся между собой по размерам, т. е. в трех случаях из четырех достаточно посчитать количество амплификатов без определения их размеров.

Не можете найти то, что вам нужно? Попробуйте наш сервис подбора литературы.

Геном Y. pestis отличается высокой степенью лабильности, особенно нестабильны межгенные участки. Существует опасность, что выбранные в качестве мишеней участки являются нестабильными, что будет затруднять дифференциальную диагностику, однако анализ «in sil-ico» показал, что данные участки присутствует во всех 34 геномах Y. pestis неосновного подвида и 25 геномах основного подвида Y. pestis, депонированных в NCBI Genome, что позволяет надеяться, что в результате ПЦР нас не будут ожидать неприятные сюрпризы.

На наш взгляд, использование разработанной тест-системы целесообразно для комплексной детекции и

дифференциации основного и неосновного подвидов Y. pestis между собой и с Y. pseudotuberculosis. Кроме того наша методика может быть самодостаточна для решения таких вопросов, как определение видовой/ подвидовой принадлежности атипичных природных изолятов и музейных штаммов; верификация неоднозначных данных, полученных с помощью других методов; эпизоотологическое обследование полевочьих очагов чумы; сравнительный мониторинг эпизоотической активности в сопряженных очагах чумы с циркуляцией на одной территории обоих подвидов Y. pestis и осуществление контроля за заносом Y. pestis из эндемичных по чуме стран.

финансирование. Работа выполнена при финансовой поддержке Российского научного фонда (грант 1415-00599).

ЛИТЕРАТУРА (пп. 1-6, 8, 11-20 см. REFERENCES)

7. Онищенко Г.Г., Кутырев В.В. (ред.). Природные очаги чумы Кавказа, Прикаспия, Средней Азии и Сибири. М.: Медицина; 2004.

9. Кутырев В.В., Попова А.Ю., Ежлова Е.Б. и др. Заболевание человека чумой в Горно-Алтайском высокогорном природном очаге в 2014 г. Сообщение 2. Особенности лабораторной диагностики и молекулярно-генетическая характеристика выделенных штаммов. Проблемы особо опасных инфекций. 2014; (4): 43-51. 10. Ерошенко Г.А., Одиноков Г.Н., Куклева Л.М. и др. Стандартный алгоритм молекулярного типирования штаммов Yersinia pestis. Журн. микробиол. 2012 (3): 25-35.

REFERENCES

1. Rasmussen S., Allentoft M.E., Nielsen K. et al. Early divergent strains of Yersinia pestis in Eurasia 5,000 years ago. Cell. 2015; 163 (3: 571-82. DOI: 10.1016/j.cell.2015.10.009.

2. Wren B.W. The yersiniae - a model genus to study the rapid evolution of bacterial pathogens. Nat. Rev. Microbiol. 2003; 1 (1): 55-64.

3. Gage K.L., Kosoy M.Y Natural history of plague: Perspectives from more than a century of research. Annu. Rev. Entomol. 2005; 50: 505-28.

4. Stenseth N.C., Atshabar B.B., Begon M. et al. Plague: past, present, and future. PLoSMed. 2008; 5 (1): e3.

5. Platonov M.E., Evseeva V.V., Dentovskaya S.V., Anisimov A.P. Molecular typing of Yersinia pestis. Mol. Genet. Microbiol. Virol. 2013; 28 (2): 41-5.

6. Perry R.D., Fetherston J.D. Yersinia pestis - etiologic agent of plague. Clin. Microbiol. Rev. 1997; 10: 35-66.

7. Onishchenko G.G., Kutyrev V.V. (Eds). Natural Foci of Plague in the Caucasus, Caspian Sea Areas, Central Asia and Siberia. Moscow: Meditsina; 2004. (in Russian)

Не можете найти то, что вам нужно? Попробуйте наш сервис подбора литературы.

8. Cui Y., Yu C., Yan Y. et al. Historical variations in mutation rate in an epidemic pathogen, Yersinia pestis. Proc. Natl. Acad. Sci. U S A. 2013; 110 (2): 577-82. doi: 10.1073/pnas.1205750110.

9. Kutyrev V.V., Popova A.Y., Ezhlova E.B. et al. Infection of an individual with plague in the Gorno-Altaisk high-mountain natural focus in 2014. Communication 2. Peculiarities of laboratory diagnostics and molecular-genetic characterization of the isolated strains. Problemy osobo opasnykh infektsiy. 2014; (4): 43-51. (in Russian)

10. Eroshenko G.A., Odinokov G.N., Kukleva L.M. et al. Standard algorithm of molecular typing of Yersinia pestis strains. Zhurn. mikro-biol. 2012 (3): 25-35. (in Russian)

11. Qi Z., Wu Y., Li Y. et al. 3a-Negative Yersinia pestis, China. Infect. Dis. Transl. Med. 2015; 1 (2): 61-2. DOI: 10.11979/idtm.201502004.

12. Armougom F., Bitam I., Croce O. et al. Genomic insights into a new Citrobacter koseri strain revealed gene exchanges with the virulence-associated Yersinia pestis pPCP1 plasmid. Front. Microbiol. 2016; 7. A. 340: 1-13. DOI: 10.3389/fmicb.2016.00340.

13. Hänsch S., Cilli E., Catalano G. et al. The pla gene, encoding plasminogen activator, is not specific to Yersinia pestis. BMC Res. Notes. 2015; 8 (535): 1-3. DOI: 10.1186/s13104-015-1525-x.

14. Janse I., Hamidjaja R.A., Reusken C. Yersinia pestis plasminogen activator gene homolog in rat tissues. Emerg. Infect. Dis. 2013; 19 (2): 342-4.

15. Li Y., Cui Y., Hauck Y. et al. Genotyping and phylogenetic analysis of Yersinia pestis by MLVA: insights into the worldwide expansion of Central Asia plague foci. PLoS One. 2009; 22 (6): e6000. DOI: 10.1371/journal.pone.0006000.

16. Kislichkina A., Bogun А., Kadnikova L. et al. Nineteen whole-genome assemblies of Yersinia pestis subspecies microtus, including

representatives of biovars caucasica, talassica, hissarica, altaica, xil-ingolensis, and ulegeica. Genome Announc. ; 3 (6): 01342-15.

17. Quintard K., Dewitte A., Reboul A. et al. Evaluation of the role of the opgGH operon in Yersinia pseudotuberculosis and its deletion during the emergence of Yersinia pestis. Infect. Immun. 2015; 83 (9). DOI: 10.1128/IAI.00482-15.

18. Laukkanen-Ninios R., Didelot X., Jolley K.A. et al. Population structure of the Yersinia pseudotuberculosis complex according to mul-tilocus sequence typing. Environ. Microbiol. 2011; 13 (12): 3114-27. doi:10.1111/j.1462-2920.2011.02588.x.

19. Achtman M. Insights from genomic comparisons of genetically mon-omorphic bacterial pathogens. Philos. Trans. Roy Soc. Lond. B. Biol. Sci. 2012; 19 (367): 860-7. DOI: 10.1098/rstb.2011.0303.

20. Leclercq A.J., Torrea G., Chenal-Francisque V., Carniel E. IS-RFLP: a powerful tool for geographical clustering of global isolates of Yersinia pestis. Adv. Exp. Med. Biol. 2007; 603: 322-6.

Поступила 05.09.16

Не можете найти то, что вам нужно? Попробуйте наш сервис подбора литературы.

Kislichkina A.A., Kadnikova L.A., Platonov ME., Maiskaya N.V., Kolombet L.V., Solomentsev VI, Bogun A.G., Anisimov A.P.

DIFFERENTIATION OF YERSINIA PSEUDOTUBERCULOSIS, YERSINIA PESTIS SUBSP. PESTIS AND SUBSP. MICROTI STRAINS AND OTHER REPRESENTATIVES OF YERSINIA PSEUDOTUBERCULOSIS COMPLEX

State Research Center for Applied Microbiology and Biotechnology, Federal Service for Surveillance on Consumer Rights Protection and Human Wellbeing, 142279, Obolensk, Russian Federation

Species Yersinia pestis includes two subspecies pestis and microti. Strains of subsp. pestis were the cause of three plague pandemics. Strains of subsp. microti circulate in populations of rodents belonging to the genus Microtus and cause only occasional diseases in humans that are not accompanied by human-to-human transmission. The existence of combined plague foci with strains from different genotypes, biovars and even the Y. pestis subspecies circulating in the same area, as well as periodic introductions of Y. pestis subsp. pestis strains into the foci from which only the strains of subsp. microti were isolated previously, require fast and reliable identification of the strain subspecies for optimization of plague prevention and control. For differentiation of Y. pestis subspecies among themselves and with Y. pseudotuberculosis we analyzed the DNA targets (YPDSF_3711 and opgG), picked up the primers, and determined the optimal concentrations of the components of the reaction mixture and temperature conditions of PCR. The suggested method allows identification according to the amplicon number and size of Y. pestis subsp. pestis (563 bp), the two phylogenetic groups of subsp. microti (SNP-types 0.PE2, 0.PE3, 0.PE4, and 0.PE5 - 583 bp, 426 bp; 0.PE7 - 779 bp, 515 bp, 358 bp), the progenitor of the plague microbe -Y. pseudotuberculosis (779 bp, 583 bp, 426 bp) and Y. similis (779 bp, 426 bp). The study was conducted on a representative set of strains from the State Research Center for Applied Microbiology and Biotechnology (http://obolensk.org/center/state-collection.htm) and nucleotide sequences deposited in the DDBJ/EMBL/GenBank. The study showed 100% specificity and susceptibility of the proposed method.

Keywords: Yersinia pseudotuberculosis, Yersinia pestis, Y. similis, identification, laboratory diagnostics

For citation: Kislichkina A.A., Kadnikova L.A., Platonov M.E., Maiskaya N.V., Kolombet L.V., Solomentsev V.I., Bogun A.G., Anisimov A.P. Differentiation of Yersinia pseudotuberculosis, Yersinia pestis subsp.pestis and subsp. microti strains and other representatives of Yersinia pseudotuberculosis complex. Molekulyarnaya Genetika, Mikrobiologiya i Virusologiya (Molecular Genetics, Microbiology and Virology 2017; 35(2): 43-548. (Russian). DOI 10.18821/02080613-2017-35-2-43-48.

For correspondence: Angelina Aleksandrovna Kislichkina, State Research Center of Applied Microbiology and Biotechnology, Federal Service for Surveillance on Consumer Rights Protection and Human Wellbeing, 142279, Obolensk, Russian Federation; E-mail: kislichkina@obolensk.org

Acknwledgments. This work was supported by the Russian Science Foundation (Grant No. 14-15-00599).

Conflict of interest. The authors declare no conflict of interest.