CC BY
44
SHORT REPORTS
Possible Function of the ribT Gene of Bacillus subtilis: Theoretical Prediction, Cloning, and Expression
A. P. Yakimov1,2, T. A. Seregina3, A. A. Kholodnyak3, R. A. Kreneva1, A. S. Mironov3,
D. A. Perumov1, A. L. Timkovskii1,2*
1B.P. Konstantinov Petersburg Nuclear Physics Institute, National Research Center "Kurchatov Institute", Orlova Roshcha, Gatchina, Leningrad Region, Russia, 188300
2St. Petersburg State Polytechnical University, Polytechnicheskaya Str., 29, St. Petersburg, Russia, 195251
3State Research Institute of Genetics and Selection of Industrial Microorganisms, 1st Dorozhnyi Proezd, 1, Moscow, Russia, 117545 *E-mail: [email protected] Received 24.04.2014
Copyright © 2014 Park-media, Ltd. This is an open access article distributed under the Creative Commons Attribution License,which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
ABSTRACT The complete decipherment of the functions and interactions of the elements of the riboflavin biosynthesis operon (rib operon) of Bacillus subtilis are necessary for the development of superproducers of this important vitamin. The function of its terminal ribT gene has not been established to date. In this work, a search for homologs of the hypothetical amino acid sequence of the gene product through databases, as well as an analysis of the homolgs, was performed; the distribution of secondary structure elements was theoretically predicted; and the tertiary structure of the RibT protein was proposed. The ribT gene nucleotide sequence was amplified and cloned into the standard high-copy expression vector pET15b and then expressed after induction with IPTG in E. coli BL21 (DE3) strain cells containing the inducible phage T7 RNA polymerase gene. The ribT gene expression was confirmed by SDS-PAGE. The protein product of the expression was purified by affinity chromatography. Therefore, the real possibility of RibT protein production in quantities sufficient for further investigation of its structure and functional activity was demonstrated.
KEYWORDS proteomics; bioinformatics; homology search; theoretical protein structure; gene cloning; inducible expression.
The main stages in the riboflavin biosynthesis in Bacillus subtilis cells have been elucidated previously. This process turns out to be controlled by two regions of the genome: the rib operon and the bifunctional flavokinase/FAD synthase gene, ribC, which is part of the truB-rpsO operon [1, 2]. The rib operon, which controls the overall pathway of riboflavin production, starting with guanosine-5’-triphosphate (starting precursor), consists of five nonoverlapping genes. These are four consecutive structural genes: ribG (encodes bifunctional aminopyrimidine deaminase/uracil reductase), ribB (riboflavin synthase gene), ribA (GTP cyclohydrolase gene), ribH (lumazine synthase gene), as well as ribT, the operon’s terminal gene, whose function has not been determined so far.
Furthermore, this operon contains three regulatory elements: the ribO regulatory region with the major promoter P1 and two additional internal promoters P2 and P3.
Conf jib:):]un:]ni Pied . '
IE
>
Pied
AA
10 20 30 40
Conf Iilllllllllillllllllllllllllllllllllllllf
=>—c
Î>-^=
Pred _
Pied CCEEEEEEECCCEEEEEEEEEECCEEEEEEEEECCCCCCC AA DRQLFLWKEDEDIVGAIGVEKKDSEVEIRHISVNPSHRKQ
50 60 70 80
Conf üllIllIlIllllllIIIllMllll=lllIIIIll3ll^33llE Pred
Pied
AA GIGKQMMDALKHLFKTQVLVPNELTQSFFERCQGQQDQDI
I I I I
90 100 110 120
Fig. 1. Secondary structure elements predicted for the ribT gene product
Previously, we determined the relative functional activity of all three operon promoters [3]. In this case, a paradox came to light: the P2 and P3 promoters, when tested separately within corresponding fragments of the operon, differed considerably in their transcriptional activity. The activity of the P3 promoter, which regulates ribT gene transcription, exceeded several times the major P1 promoter activity. The P2 promoter, on the contrary, was tens of times weaker than P1. However, neither P2 nor P3 is regulated by flavins, but it is known that when the entire rib operon is transcribed under the major P1 promoter control, all elements of the operon are transcribed in concert to form a polycistronic mRNA [4]. And this is despite the presence of several promoters that differ in their transcriptional activity and regulatory mechanisms.
The ribT (ypzK in other nomenclatures) gene function still remains quite unclear. Indirect indications have been obtained that mutations in the ribT gene affect the rib operon activity and riboflavin accumulation. For example, Perkins et al. [5] demonstrated that the ribT gene inactivation does not lead to riboflavin auxotrophy, but it significantly reduces the riboflavin yield in producer strains. This suggests that the ribT gene function is important for the riboflavin biosynthesis, but it may become limiting at maximum intensity of riboflavin biosynthesis.
Therefore, elucidating the function of a ribT gene product may provide additional opportunities for the development of commercially promising superproducers of riboflavin, which is one of the most important vitamins.
RibT
3EY5
2K5T
3FRM
3BLN
2G3A
1Z4R
1N71
M- -LIRYKkI.....U.........tciAMGLLS - FMP-
I--RFQPITT-.....■--|QHYKFXEELLvl-SFP-
m- -kltiiriS----I---^kfsdqdridl|-kiw-
- -VDIQLVSS.....I------nindylhvydI-HJp:
GXKNVTKASI------D------DLDSIVHIDID-Viq-
XNF ----------------VLSDVADAEAEKAIRDPL-
giiefhvignsltpka|trrvllwlvglqnvfsh-q:
M- - IISEFDR----NN»- - VLKDQLSDLLRL-
NEKDLKQLQQTI- -KDYETDTDRQLFLWKED-EDIV 54
PE -EYRELEHLR- -EYTDRIGNFHNNIIFDD-DLPI 58
PE-YB.......1- -jSSLQVDDNHRIYAARFN-ERLL 49
GDSYANXVKQHI- - YSSYNLDDIERLVAYVN-HQPV 58
-.....1- -Isrrnyikhsidegrcvivked-nsis 52
B-----aynl|--rfgesdkrdlnitirnddnsvt 49
------PKEYI--ARLVFDPKHKTLALIKD-GRVI 64
YGDSSAE-E--VEEMMNPERIAVAAVDQ-DELV 57
Conserved
sequence
75
RibT
3EY5
2K5T
3FRM
3BLN
2G3A
1Z4R
1N71
55 GAIGVEKK- -DSEVEIRHISVNPSHRHQGIGKQMMDALKHLFK-------TQVLV-P----------------- 101
59 GFITYWDF- -DEFYYVEHFATNPALRNGGYGKRTLEHLCEFLK----RPIVLEVERP----------------- 109
50 AAVRVTLS-- GTEGALDSLRVREVTRRRGVGQYLLEEVLRNNP---GVSCWWMADAG----------------- 101
59 GIVDIIXT--DKTIEIDGFGVLEEFQHQGIGSEIQAYVGRXAN----ERPVILVADGK----------------- 110
53 GFLTYDTNF- FDCTFLSLIIVSPTKRRRGYASSLLSYXLSHSP---TQKIFSSTNES................. 105
50 GGLVGHTAR- -GWLYVQLLFVPEAXRGQGIAPKLLAXAEEEARKRGCXGAYIDTX-------------------- 102
65 GGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYAD--------------------- 119
5 8 GFIGAIPQYGITGWELHPLWESSRRKNQIGTRLVNYLEKEVASRGGITIYLGTDDLDHGTTLSQTDLYEHTFDK 13 2
Conserved
sequence
76
150
RibT 3EY5 2K5T 3FRM 3BLN 2G3A 1Z4R 1N71
Conserved
sequence
BAD AVG GOOD
102--------jfELTQSFFERCQGQQDQD------------------------------------------|-|YNN 124
110 ---VEEXAKRRINFYQRH-GFTLWEKDYYQPPYKEGDDFLPXYLXVHGN LDAEKDYEGIRHKLHTfVYGVK
10 2 VED - RGVMTAFMQAL - GFTTQ-------------------------------QGGWE
HI ---------DTAKDXYLRQ - GYVYQGFKYH.......................■..1--..
106........NESXQKVFNaI-IfIRSGIVEN-........tPEGDPEIIFYTK...........
10 3.......NPDALRTYERY-fFTKIG........-feLGPLSSGQSITWLEKR
-|CG
-ENI
-KLR
-F
120.......-EYAIGYFKKQ-ÇFSKDIKVPKSRYLGYIKDYEGATLMECEL-.............-■---PR
133 VASIQNLREHPYEFYEKL-GYKIVGVLPN----ANGWDKPDIWMAKTI...............|-|RPD
■■I ■ I ■ IB
176
128
136 142
137 162 180
221
Fig. 2. Multiple alignment of the amino acid sequence of the ribT gene protein product to the assumed homologs (the description of the color scheme is provided at http://www.jalview.org/help/html/colourSchemes/clustal.html)
Fig. 3. Proposed tertiary structure for the ribT gene product in a complex with acetyl-CoA
Based on the known nucleotide sequence of the ribT gene, the amino acid sequence of its protein product was deduced. The hypothetical protein consists of 124 amino acids and has a molecular weight of 14.5 kDa. The prediction of the regions that form, with a high probability, the elements of the secondary structure (Fig. 1) was made using the PSIPRED service [6].
Then, based on this sequence, the search for homologs was carried out and a multiple alignment of the sequence of the ribT gene protein product was performed using the Clustal software [5] only among the proteins with structures deposited in the PDB [7] (Fig. 2).
Of them, 1N71, 3FRM, 2G3A, 1Z4R, 3EY5, 2K5T, and 3BLN were selected, and based on homology, the structure presented in Fig. 3 was built. Since acetyl CoA is present in the crystal structures of some homologous proteins, ligand docking to the hypothetical structure was carried out using the Molsoft ICM Pro software package [8].
Since most of the selected homologous proteins (except 3FRM, whose function is unknown) were acetyl transferases, the hypothetical ribT gene product could be assumed also to belong to this class of enzymes.
We assumed that the role of this gene’s protein product might be the acetylation of the N(5) atom of flavins that results in the production of their reduced forms and maintains a high transcriptional level for the rib operon. Previously, with our participation, the mechanism of transcriptional inhibition through the direct interaction of flavins with the leader sequence of mRNA was established [9]. The consistency of our assumption is confirmed by the fact that the inhibitory transcriptional interaction with the leader sequence of a sensory RNA is performed by the oxidized form of FMN [10].
Therefore, the acetyl reduction produced by the ribT gene product may be important for maintaining a high level of riboflavin synthesis. This assumption requires direct experimental verification.
This defines the objective of further research that is to perform the full cycle of ribT gene expression in a preparative mode, to produce sufficient quantities of the purified native protein product, and to test directly its functional (enzymatic) activity in vitro.
To test the possibility of expression, the ribT gene was amplified from chromosomal DNA of B. subti-lis using the primers RibT10, 5’-CGCCATATGTTA-ATTCGTTATAAAAAATCGTTT-3’, and RibT11, 5’-cGccTcGAGTAATTATTGTATGAAATGTcTT-GATc-3’, (the oligonucleotides used in this study were synthesized at Evrogen). The first oligonucleotide is complementary to the proximal region, and the second is complementary to the distal region of the ribT gene. PCR was performed on a MyCycler thermal cycler (BioRad) according to the following scheme: first, cells were disrupted at 95 °C for 3 min, then 25 cycles of amplification were carried out that included DNA denaturation at 95 °C for 30 s, primer annealing at 60 °C for 30 s, and completion of DNA at 72 °C for 30 s. At the last stage, completion of DNA was done at 72 °C for 2 min. As a result, a fragment of 372 bp was synthesized that contained the structural region of the ribT gene flanked by the restriction enzyme recognition sites, NdeI and Xhol. After electrophoretic separation of PCR products, the desired DNA fragment was eluted from the gel using a GeneClean kit (Fermentas). The ribT gene was cloned into the pET15b high-copy expression vector containing the T7 phage promoter, which is inducible by isopropyl P-D-1-thiogalactopyranoside (IPTG), at the restriction endonuclease sites NdeI and XhoI. The PET15b vector comprises nucleotide sequences for His-Tag before the Ndel restriction enzyme recognition site and for the target site of thrombin. E. coli TGI strain cells were transformed with the resulting ligase mixture. Selection of transformants was performed in a LB agar medium containing ampicillin as a selection marker. Screening for recombinant clones was performed by PCR using the plasmid primers pT7P, 5’-TAATACGACTCACTATAGGGG-3’, and pT7T, 5’-GCTAGTTATTGCTCAGCGGT-3’. Plasmid DNA was isolated from the selected transformants, and the presence of insertion in hybrid plasmids was determined using a restriction analysis. These plasmids, designated as pET15b/ribT, were used to transform cells of the E. coli BL21 (DE3) strain containing the inducible T7 bacteriophage RNA polymerase gene.
The RibT protein synthesis was induced by adding IPTG to the growth medium at a final concentration of 1 mM. The ribT gene expression was determined by
polyacrylamide gel electrophoresis under denaturing conditions (SDS-PAGE) for a total protein from E. coli BL21 (DE3) cells containing the pET15b/ribT plasmid. As a control, the lysate of BL21 (DE3) strain cells containing the pET15b plasmid without the insertion was used (Fig. 4A).
An additional fraction of a protein with a molecular weight of approximately 14.5 kDa is observed in the cell lysate of the BL21 (DE3) strain containing the pET15b/ribT plasmid after IPTG mediated induction, which is consistent with the predicted molecular weight of the RibT protein (see above).
The His-Tag-labeled recombinant RibT protein was isolated using TALON® Magnetic Beads (Clontech, USA). Cells of the E. coli BL21 (DE3) strain containing the pET15b/ribT plasmid, grown in the presence of 1 mM IPTG, were harvested by centrifugation. The biomass was re-suspended in a buffer of the following composition: 20 mM sodium phosphate, pH 7.0, 300 mM NaCl, and 20 mM imidazole. The cells were disrupted by sonication and centrifuged at 14,000 rpm for 20 min. The supernatant was incubated with TALON® Magnetic Beads at 4 °C for 1 h. The resin was then washed with four volumes of the same buffer. Elution of the protein was performed with a buffer: 20 mM sodium phosphate, pH 7.0, 300 mM NaCl, and 300 mM imidazole. The eluted protein’s fractions were analyzed by SDS-PAGE electrophoresis (Fig. 4B). Lines 7-10 belonged to the target protein with a high degree of purity and a molecular weight of about 14.5 kDa, which is in good agreement with the theoretical prediction.
CONCLUSiONS
The theoretical amino acid sequence and analysis of ribT gene product homologs in the PDB allowed us to perform molecular modeling and predicting of the pos-
1234 123456789 10
Fig. 4. SDS-PAGE analysis of the ribT gene expression and recombinant RibT protein purification.
A total protein fraction from E. coli BL21(DE3) cells.
Line 1: a protein marker; line 2: a protein fraction from E. coli BL21(DE3) cells with the pET15b plasmid without ribT gene insertion; line 3: a protein fraction from E. coli BL21(DE3) cells with the pET15b/ribT plasmid, grown without IPTG addition; line 4: protein fraction from E. coli BL21(DE3) cells with the pET15b/r/'bT plasmid, grown in the presence of 1 mM IPTG.
A protein fraction from E. coli BL21(DE3) pET15b/ ribT cells before and after affinity sorption on TALON® Magnetic Beads. Line 1: a protein marker; line 2: a total protein fraction from E. coli BL21(DE3) pET15b/ribT cells after IPTG induction; lines 3-6: protein fractions with proteins unbound to the affinity sorbent; lines 7-10: fractions of the His-Tag-labeled RibT protein successively eluted from the affinity sorbent with 300 mM imidazole
sible three-dimensional structure of the protein. The ribT gene expression was experimentally implemented, and the possibility, in principle, to produce the RibT protein in quantities sufficient for further investigation of its structure and functional activity was proved.
This work was supported by the Russian Foundation for Basic Research (grant № 11-04-00476).
REFERENCES
1. Chikindas M.L., Mironov V.N., Lukyanov E.V., Boretsky Yu.R., Arutyunova L.S., Rabinovich P.M., Stepanov A.I.
// Mol. Gen. Mikrobiol. Virusol. (Russian). 1987. V. 4. № 1. P. 22-26.
2. Mironov V.N., Perumov D.A., Kraev A.S., Stepanov A.I., Skryabin K.G. // Mol. Biol. (Russian). 1990. V. 24. № 3.
P. 256-261.
3. Sklyarova S.A., Kreneva R.A., Perumov D.A., Mironov A.S. // Genetika (Russian). 2012. V. 48. № 10. P. 1-9.
4. Mironov V.N., Kraev A.S., Chikindas M.L., Chernov B.K., Stepanov A.L.. Skryabin K.G. // Mol. Gen. Genet. 1994.
V. 242. № 2. P. 201-208.
5. Perkins J.B., Sloma A., Hermann et al. // J. Ind. Microbiol. Biotechnol.. 1999. V. 22. P. 8-18.
6. Jones D.T. // J. Mol. Biol. 1999. V. 292. P. 195-202.
7. Bernstein F.C., Koetzle T.F., Williams G.J., Meyer Jr. E.E., Brice M.D., Rodgers J.R., Kennard O., Shimanouchi T., Ta-sumi M. // J. Mol. Biol. 1977. V. 112. № 3. P. 535-542.
8. Abagyan R.A., Totrov M.M., Kuznetsov D.N. // J. Comp. Chem. 1994. V. 15. P. 488-506.
9. Mironov A.S., Gusarov I., Rafikov R., Errais Lopez L., Shatalin K., Kreneva R.A., Perumov D.A., Nudler E. // Cell. 2002. V. 111. № 4. P. 747-756.
10. Serganov A., Huang L., Patel D.J. // Nature. 2009. V. 458.
P. 233-237.
