Научная статья на тему 'Антимикробные пептиды меда, перспективы их получения и использования'

Антимикробные пептиды меда, перспективы их получения и использования Текст научной статьи по специальности «Биологические науки»

CC BY
732
74
i Надоели баннеры? Вы всегда можете отключить рекламу.
Ключевые слова
АНТИМИКРОБНЫЕ ПЕПТИДЫ / МЕД / МЕТОДЫ ВЫДЕЛЕНИЯ ПЕПТИДОВ

Аннотация научной статьи по биологическим наукам, автор научной работы — Клыченков Сергей Викторович

Мед издревле применялся в народной медицине как комплексное укрепляющее средство, содержащее в своем составе множество биологически активных веществ, в том числе пептиды с антимикробной и иммуномодулирующей активностью. Рассказывается о функциях и строении антимикробных пептидов (АМП), вероятности нахождения их в меде и перспективе их получения и использования.

i Надоели баннеры? Вы всегда можете отключить рекламу.

Похожие темы научных работ по биологическим наукам , автор научной работы — Клыченков Сергей Викторович

iНе можете найти то, что вам нужно? Попробуйте сервис подбора литературы.
i Надоели баннеры? Вы всегда можете отключить рекламу.

Текст научной работы на тему «Антимикробные пептиды меда, перспективы их получения и использования»

АКТУАЛЬНЫЕ ВОПРОСЫ ЕСТЕСТВОЗНАНИЯ

УДК 577.12

С. В. Клыченков

АНТИМИКРОБНЫЕ ПЕПТИДЫ МЕДА, ПЕРСПЕКТИВЫ ИХ ПОЛУЧЕНИЯ И ИСПОЛЬЗОВАНИЯ

Аннотация. Мед издревле применялся в народной медицине как комплексное укрепляющее средство, содержащее в своем составе множество биологически активных веществ, в том числе пептиды с антимикробной и иммуномодулирующей активностью. Рассказывается о функциях и строении антимикробных пептидов (АМП), вероятности нахождения их в меде и перспективе их получения и использования.

Ключевые слова: антимикробные пептиды, мед, методы выделения пептидов.

Введение

Очевидной проблемой настоящего времени является приобретение патогенными микроорганизмами устойчивости к антибиотикам [1], что толкает исследователей и всю фармакологическую промышленность в целом на поиск новых действенных методов для борьбы с бактериальной угрозой. Большой потенциал в этой области содержат в себе антимикробные пептиды (АМП) - короткие белковые молекулы, которые синтезируются в ответ на появление в организме чужеродных бактерий, грибков или вирусов [2] практически во всех живых организмах - от бактерий до позвоночных и человека [3], у которого они выделяются практически всеми клетками иммунной системы: фагоцитами, лейкоцитами, нейтрофилами, макрофагами и т.д.

Антимикробные пептиды, их механизм действия

Интерес к изучению антимикробных пептидов появился вскоре после выделения Александром Флемингом в конце 20-х гг. XX в. человеческого лизоцима, но из-за малого его клинического значения и на фоне эйфории по поводу антибактериальных свойств пенициллина он в значительной мере угас. Однако в 1980 г. был выделен антимикробный пептид из куколки мотылька цекропии [4], а в 1985 г. была показана антигрибковая [5] и противовирусная [6] активность для АМП из лейкоцитов кролика. Эти же пептиды были найдены и у человека и названы дефензинами. Позже были выделены дефензины плазменной локализации, а также с поверхности кожи. С тех пор открыто более 1900 различных антимикробных пептидов, но стройной и изящной классификации этих молекул выведено так и не было из-за их значительного разнообразия. На сегодняшний день существует несколько классификаций АМП, однако наибольшее распространение получило деление пептидов по их происхождению или строению: I. По месту синтеза:

а) рибосомальные - присутствуют во всех группах организмов и синтезируются прокариотами и эукариотами;

б) нерибосомальные - синтезируются бактериями и грибами (так называемые бактериоцины).

II. По строению:

а) а-спиральные (человеческий кателицидин);

б) Р-складчатые (человеческие дефензины);

в) с нерегулярной структурой (коровий индолицидин);

г) «петли и циклы» (циклический дефензин макак-резусов).

Также немаловажно отметить, что все АМП можно разделить по заряду на катион-ные и анионные.

Широкий спектр действия антимикробных пептидов обусловлен механизмом их работы. На сегодняшний день существует несколько теорий о том, как АМП влияют на жизнедеятельность бактериальной клетки (не исключено, что все они имеют место).

Прежде всего действие катионных АМП направлено на изменение свойств бактериальной клеточной мембраны [7]. В больших концентрациях пептиды перфорируют мембрану, образуя в непрерывном билипидном слое поры. Существует две модели, описывающие это взаимодействие: бочки и ковра. В обоих случаях положительно заряженные пептиды электростатически притягиваются к отрицательно заряженному липидному слою мембраны и формируют поры, которые нарушают проницаемость плазмалеммы. В соответствии с моделью «бочка» можно предположить, что в мембране образуется белковый канал, который изнутри выстлан антимикробными пептидами и проницаемость которого бактериальная клетка регулировать не может, что ведет к нарушению ее функционирования. В случае модели «ковра» АМП заключают в своеобразную пептидную везикулу часть липидов мембраны, что также ведет к образованию неконтролируемых пор.

Однако взаимодействие с мембранами не ограничивается только образованием пор. В небольших концентрациях АМП (например, грамицидин Б) могут образовывать агрегаты с липидами мембраны, что изменяет трансмембранный потенциал, а это так же губительно для бактериальной клетки, как и перфорирование. Более того, антибактериальная активность некоторых пептидов зависит от их хиральности, что доказывается разной активностью Ь- и Б-энантиомеров [8]. Из этого можно сделать вывод, что АМП могут атаковать также и некоторые бактериальные рецепторы.

В противоположность катионным антимикробным пептидам, количество открытых анионных очень и очень мало. Из более чем сотни [9] АМП, выделенных из человеческих биологических жидкостей, только 15 являются анионными. На сегодняшний день анионные АМП найдены в дыхательных путях (суфрактант-ассоциированный анионный пептид - БААР), в головном мозге (дермцидин - БСБ, тимозин-РД в эпителии (БСБ и его производные), в придатке яичка (анионный Р-дефензин), в кровотоке (компоненты фибриногена - фибринопептиды А и В, аполипопротеин С111). Уникальным путем образуются анионные АМП в желудочно-кишечном тракте - из белков пищи. Например, каппа-цины А и В, проявляющие активность против широкого спектра грамположительных и грамотрицательных бактерий, являются продуктами протеолизак-казеина химозином. Малая изученность анионных антимикробных пептидов является причиной и наших скудных знаний об их механизме действия. Предполагается, что многие анионные АМП находятся в комплексе с ионами металлов, что позволяет им взаимодействовать с отрицательно заряженной бактериальной мембраной, образуя солевые мостики - слабые электростатические связи между разноименно заряженными молекулами.

Еще одной замечательной способностью антимикробных пептидов является их комплексность действия, т.е. они не только обладают противопатогенной активностью, но и способны к иммуномодуляции. В более полной мере иммуномодулирующая способность человеческих АМП изучена для кателицидинов и дефензинов. Характерной особенностью такой иммунной стимуляции является широкая направленность действия.

Например, кателицидины оказывают прямое хемоаттрактивное действие на моноциты, нейтрофилы, CD4+ T-лимфоциты, взаимодействуя с их формил-пептидоподобным рецептором первого типа [10]. Invitro замечено, что кателицидины индуцируют транскрипцию хемокинов (IL-8, хемоаттракторные белки моноцитов I и III (MCP-1, MCP-3)) [11]. Ко всему прочему, кателицидины активируют высвобождение гистамина тучными клетками, что увеличивает проницаемость сосудов, тем самым способствуя инфильтрации ней-трофилов к очагам воспаления [12]. Дефензины, как и кателицидины, оказывают свое действие на определенное количество иммунокомпетентных клеток. Все три типа этих пептидов (hBD-1, hBD-2 и hBD-3) усиливают хемотаксис T-клеток и незрелых дендритных клеток путем прямого связывания с хемокиновым рецептором CCR6. В тучных клетках hBD-2 инициирует процессы миграции и дегрануляции, в моноцитах - синтез различных хемокинов и цитокинов, а через TLR-4 способствует созреванию дендритных клеток. При низких концентрациях а-дефензины активируют пролиферацию фибробла-стов и эпителиальных клеток в дыхательных путях [13]. Оба типа АМП способы вызывать фенотипические и функциональные изменения в дендритных клетках, а кателицидины еще и увеличивают антигенрепрезентирующую активность Т^-клеток.

Антимикробные пептиды пчел

Как уже упоминалось, антимикробные пептиды можно найти практически во всех живых организмах. К настоящему времени из гемолимфы пчел ApisMellifera выделено два типа антибактериальных пептидов: апидаецины и абаецины.

Как указывается авторами оригинального исследования [14], апидаецин (GNNRP(V/I) YIPQPRPPHPR(L/I)) является основным гуморальным фактором иммунитета медоносной пчелы. В аминокислотной последовательности этого АМП 33 % составляет пролин, что исключает возможность спиральной структуры. Апидаецины являются катионными антимикробными пептидами; всего идентифицировано три формы: Ia, Ib и II. Они обладают высокой стабильностью, не теряют своих свойств при pH = 2 и высокой температуре, в гемолимфе взрослых пчел находятся преимущественно в активной форме, в то время как у личинок большая их часть циркулирует в виде предшественника. Апидаецины высокоактивны против многих патогенов растений и некоторых человеческих, но только грамотрицательных бактерий, и оказываемое на них действие бактериостатическое, а не литическое.

Как было выяснено Castle и др. в 1991 г. [15], целью апидаецина является белок-синтезирующий аппарат бактерий, т.е. апидаецины не атакуют бактериологическую мембрану. В работе было показано, что эти пептиды неспецифически проникают через внешнюю оболочку грамотрицательных бактерий, попадают в периплазматическое пространство, свободно проходят через клеточную мембрану и ингибируют синтез белка в бактериях. Другая более поздняя работа Otvos с соавторами [16] показала, что мишенью апидаецинов являются шапероны, а это нарушает нормальный процесс фолдинга белков. Исходя из того факта, что апидаецины активны только в отношении грамотрица-тельных бактерий, ассоциированных с растениями, можно предположить, что эти пептиды - эволюционное приобретение пчел для защиты от наиболее встречаемых угроз. Сообщается, что искусственно синтезированный апидаецин обладает ничуть не меньшей антибактериальной активностью, чем его природный вариант, что является аргументом за использование этого АМП в качестве противобактериологического препарата наравне с отсутствием токсичности.

Другой тип АМП, синтезируемых пчелами - абаецины - является менее активным антибактериальным компонентом, чем апидаецины (по отношению к грамотрицатель-ным микроорганизмам), но проявляет высокую активность против бактерий рода Xanthomonus, которые устойчивы к апидаецинам, а также более высокую активность

против грамположительных микроорганизмов. Длина этого пептида - 34 а. о. (YVPLPNVPQPGRRPFPTFPGQPGNPKIKWPQGY); отмечается высокое содержание проли-на (10 а. о., которые равномерно распределены по всей молекуле, что также исключает сворачивание в а-спираль), замедленное бактериостатическое действие. В отличие от апидаецина, который обнаруживается в гемолимфе спустя короткое время после заражения, максимальное содержание абаецина регистрируется только на вторые сутки. Зависимость антибактериальной активности от условий среды - еще одно отличие. Когда апидаецин исправно выполняет свои функции при низких значениях рН и высоких температурах, абаецин проявляет максимум антибактериальной активности при малой ионной силе.

Дальнейших исследований с целью расширить знания о механизме действия абае-цина или попыток синтезировать не проводилось (или они не были опубликованы). Отсутствуют также данные и о механизмах синтеза не только абаецина, но и апидаецина; высказываются лишь предположения, что их предшественником может быть антимикробный пептид диптерицин, который встречается в личинках РКоттхатедгпа, но не встречается во взрослых формах. Об этом свидетельствует и близкий аминокислотный состав [17], и намного большая масса диптерицина, однако кардинальное различие в скорости действия апидаецина и двух остальных АМП, а также различия к требованиям внешней среды, разная антимикробная активность и направленность, временные различия в синтезе являются еще не преодоленными противоречиями в теории литического происхождения АМП пчел.

Не исключено, что пчелы-кормилицы, вырабатывая мед, секретируют в него не только гидролазы, которые расщепляют сахар, но и другие, не менее важные белковые и пептидные вещества, которые предохраняют мед от порчи, повышают его питательную ценность и превращают в настоящий кладезь полезных свойств. Косвенно наличие АМП подтверждает тот факт, что даже в разведенном состоянии мед способен оказывать бак-териостатическое действие на грамотрицательные бактерии [18]. Не исключено также и открытие новых типов антибактериальных пептидов, катионных и анионных, которые оказывают не только бактериостатическое действие на грамотрицательные микроорганизмы, но также и противовирусный и антигрибковый эффект, что может послужить практической и доказательной базой для дальнейших исследований в этой области с целью выделения и практического использования антибактериального препарата нового типа, не вызывающего резистентности и обладающего комплексным действием, малой токсичностью и иммуномодулирующим свойством.

Примерный план и перспективы выделения антибактериальных пептидов из меда

Весь путь до получения чистого препарата АМП из меда можно представить в виде условной «дорожной карты»:

1) приготовление и подготовка исходного раствора;

2)сепарация;

3) очистка от углеводов;

4) очистка и концентрирование;

5) аналитический этап, выделение индивидуальных пептидных фракций.

Пожалуй, первые два этапа - самые легкие. Действительно, приготовление водного

раствора меда определенной концентрации сложности не представляет. Легко можно справиться и с сепарацией - делением раствора на различные фракции в зависимости от молекулярного веса. Это можно осуществить с помощью ультрафильтрации в тангенциальном потоке жидкости через высокоселективную мембрану, которая отсекает молекулы определенной массы (так как предстоящая задача - выделение пептидов, то мак-

симально допустимый размер пор тот, через который проходят молекулы массой 10 кДа -общепринятая верхняя граница массы пептидов). Полученный фильтрат с частицами массой от 10 кДа и меньше можно для дополнительного фракционирования профильтровать через мембраны с меньшим размером пор.

Мед в среднем на 70 % состоит из углеводов [19], поэтому следующий этап выделения пептидов - удаление из раствора углеводов, потому что их высокая концентрация затрудняет любые последующие действия, а то и вовсе делает их невозможными. Это можно осуществить либо ионообменной, либо афинной хроматографией. В первом случае разделения можно добиться за счет ионных взаимодействий между заряженными пептидами и функциональными группами носителя, при этом параллельно разделить пептиды на анионные и катионные, что сильно упрощает дальнейший анализ. При ионообменной хроматографии в свободном объеме колонки выходят несорбировавшиеся углеводы, пептиды и другие молекулы, прошедшие ультрамембрану, а сорбировавшиеся определенного заряда пептиды выходят в последующих фракциях после смены буферного раствора. При афинной хроматографии целесообразно использовать сорбенты, имеющие сродство к углеводам, т.е. в свободном объеме должны выходить все остальные молекулы, но не сахара - глюкоза и фруктоза. Однако использование афинной хроматографии нецелесообразно, так как, во-первых, количество сорбированных углеводов конечно, и зачастую оно может быть намного ниже, чем их содержится в растворе, а во-вторых, очистка ограничивается только удалением углеводов, и пептиды остаются в смеси с остальными низкомолекулярными компонентами раствора меда.

Следующий шаг - очистка и концентрирование - фактически представляет из себя пробоподготовку перед аналитическим этапом. Во-первых, полученные фракции пептидов после ионообменной (или афинной) хроматографии находятся в буферном растворе, наличие которого может помешать или быть вовсе токсичным для биологических тестов (например, трис-основание); во-вторых, концентрация пептидного компонента фракции мала для сколько-нибудь практического применения (весь белковый компонент цветочного меда составляет примерно 1 %, пептидов из них — 50 %), поэтому необходимо несколько собранных фракций лиофильно высушить, перерастворить в малом объеме и очистить от компонентов буферного раствора. Для последнего разумно будет использовать метод гель-фильтрации на сефадексе 0-25 (параметры колонки должны быть подобраны так, чтобы во время разделения не происходило размытия пептидного пика, иначе понадобится еще один раз проводить лиофильное высушивание).

Аналитический этап - самая обширная и разнообразная по методам стадия исследования. На аналитическом этапе главная задача - провести количественный и качественный анализ полученных пептидных фракций, получить отдельные виды пептидов. Самый легкодоступный и практичный метод - обращенно-фазовая высокоэффективная жидкостная хроматография (ОФ-ВЭЖХ), особенностью которой является большая гибкость в отношении условий хроматографирования, потому что намного легче сменить подвижную фазу (что повлечет за собой изменение параметров системы), чем сорбент. Еще одним несомненным плюсом ОФ-ВЭЖХ является возможность смены колонки с аналитической на препаративную, что позволит получить достаточное количество индивидуальных пептидов для дальнейших исследований: тесты на иммунотропность и антибактериальную активность. Пожалуй, эта часть - самая интересная в изучении пептидов меда, потому что перед исследователем открывается чрезвычайно широкий выбор в дальнейших методиках - от простейших тестов на выживаемость и антибактериальную активность, описанных в «Руководстве по проведению доклинических исследований лекарственных средств» [19], до работы с клеточными линиями, анализа пролиферации спленоцитов и уровня фагоцитоза макрофагов [20]. Не стоит забывать, что полученные данные нужно подкрепить исследованием на цито- и иммунотоксичность, чтобы выявить

такую оптимальную концентрацию пептидов, которая при применении в фармакологической практике не оказывала бы значимых побочных воздействий при надлежащей эффективности.

Наконец, стоит отметить, что подтверждение высказанной теории о том, что в меде содержатся биологически активные пептиды, даст стимул для дальнейших исследований не только меда, но и других продуктов пчеловодства, что выведет их из «серой зоны» народной медицины в широкое практическое применение медицины доказательной.

Библиографический список

1. Antimicrobial Resistance and the Alternative Resources with Special Emphasis on Plant-Based Antimicrobials - A Review / C. Harish, P. Bichnoi, A. Yadav, A. P. Mishra, A. R. Nautiyal // Plants. - 2017. -Vol. 6, iss. 2. - P. 16.

2. Алешина, Г. М. Современная концепция об антимикробных пептидах как молекулярных факторах иммунитета / Г. М. Алешина, В. Н. Кокряков, О. В. Шамова, Д. С. Орлов // Медицинский академический журнал. - 2010. - № 4. - С. 149-160.

3. Zasloff, M. Antimicrobial peptides of multicellular organisms / M. Zasloff // Nature. - 2002. -№ 415. - P. 389-395.

4. Hultmark, D. Insect Immunity. Purification and Propeties of Three Inducible Bactericidal Proteins from Hemolymph of Immunized Pupae of Hyalophoracecropia / D. Hultmark, H. Steiner, T. Rasmuson, H. G. Boman // Eur. J. Biochem. - 1980. - № 106. - P. 7-16.

5. Selsted, M. E. Activity of rabbit leukocyte peptides against Candida albicans / M. E. Selsted, D. Szklarek, T. Ganz, R. I. Lehrer // Infect. Immun. - 1985. - Vol. 49, № 1. - P. 202-206.

6. Lehrer, R. I. Direct inactivation of viruses by MCP-1 and MCP-2, natural peptide antibiotics from rabbit leukocytes / R. I. Lehrer, K. Daher, T. Ganz, M. E. Selstd // Infect. Immun. - 1985. - Vol. 54, № 2. -P. 467-472.

7. Hongxia, Zhao. Mode of Action of Antimicrobial Peptides : Academic Dissertation / Hongxia Zhao. - Helsinki, 2003. - P. 98.

8. Vunnam, S. Synthesis and antibacterial action of cecropin and proline-arginine-rich peptides from pig intestine / S. Vunnam, P. Juvvadi, R. B. Merrifield // J. Pept. Res. - 1997. - Vol. 49. - P. 59-66.

9. Human Antimicrobial Peptides in Bodily Fluids: Current Knowledge and Therapeutic Perspectives in the Postantibiotic Era / P. Bastos, F. Trindade, J. D. Costa, R. Ferreira, R. Vitorino // Medical Research reviews. - 2017. DOI: 10.1002/med.21435.

10. LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilizes formyl peptide receptor-like 1 (FPRL1) as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cells / Y. De, Q. Chen, A. P. Schmidt, G. M. Anderson, J. M. Wang, J. Wooters // J Exp Med. -2000. - № 192 (7). - P. 1069-1074.

11. Impact of LL-37 on anti-infective immunity / D. M. Bowdish, D. J. Davidson, Y. E. Lau, K. Lee, M. G. Scott, R. E. Hancock // J Leukoc Biol. - 2005. - № 77 (4). - P. 451-459.

12. Evaluation of the effects of peptide antibiotics human beta-defensins-1/-2 and LL-37 on hista-mine release and prostaglandin D(2) production from mast cells / F. Niyonsaba, A. Someya, N. Hirata, H. Ogawa, I. Nagaoka // Eur J Immunol. - 2001. - № 31 (4). - P. 1066-1075.

13. Defensins are mitogenic for epithelial cells and fibroblasts / C. J. Murphy, B. A. Foster, M. J. Mannis, M. E. Selsted, T. W. Reid // J Cell Physiol. - 1993. - № 155 (2). - P. 408-413.

14. Apidaecins: antibacterial peptides from honeybees / P. Casteels, C. Ampe, F. Jacobs, M. Vaeck, P. Tempst // The EMBO Journal. - 1989. - Vol. 8, № 8. - P. 2387-2391.

15. Castle, M. Lethal effects of apidaecin on Escherichia coli involve sequential molecular interactions with diverse targets / M. Castle, A. Nazarian, S. S. Yi, P. Tempst // J Biol Chem. - 1999. - № 274. -P. 32555-32564.

16. Interaction between heat shock proteins and antimicrobial peptides / L. Jr. Otvos, I. O, M. E. Rogers, P. J. Consolvo, B. A. Condie, S. Lovas // Biochem. - 2000. - № 39. - P. 14150-14159.

17. Purification and characterization of a family of novel inducible antibacterial proteins from immunized larvae of the dipteran Phormiaterranovae and complete amino-acid sequence of the predominant member, diptericin A / J.-L. DiMarcq, E. Keppi, B. Dunbar, J. Lambert, J.-M. Reichhart, D. Hoff-

mann, S. M. Rnkine, J. E. Fothergill, J. A. Hoffmann // European Journal of Biochemistry. - 1988. -Vol. 171, iss. 1-2. - P. 17-22.

18. Abu Taib Mohammad Mobarok Ali. Inhibitory effect of natural honey on Helicobactor pylori / Abu Taib Mohammad Mobarok Ali, Mohammad Nurul Haque Chowdhury, Mohammad Saad Al Humayyd / / Tropical gastroenterology. - 1991. - Vol. 12, № 3. - P. 139-142.

19. Миронов, А. Н. Руководство по проведению доклинических исследований лекарственных средств. Часть первая / под ред. А. Н. Миронова. - М. : Гриф и К°, 2012. - 944 с.

20. Isolation, chemical characterization, and immunomodulatory activity of naturally acetylated hemicelluloses from bamboo shavings / J-q. Huang, R-t. Qi, M-r. Pang, C. Liu, G-y. Li, Y. Zhang // Journal of Zhejiang University-SCIENCE B (Biomedicine & Biotechnology). - 2017. - № 18 (2). -P. 138-151.

Клыченков Сергей Викторович, магистрант, Пензенский государственный университет. E-mail: 79048510599@ya.ru

УДК 577.12 Клыченков, С. В.

Антимикробные пептиды меда, перспективы их получения и использования / С. В. Клыченков // Вестник Пензенского государственного университета. - 2017. - № 4 (20). - С. 60-66.

i Надоели баннеры? Вы всегда можете отключить рекламу.