Научная статья на тему 'Получение, очистка и антигенные свойства рекомбинантного полипептида, включающего сн2-сн3 домены Fс-фрагмента иммуноглобулина g человека'

Получение, очистка и антигенные свойства рекомбинантного полипептида, включающего сн2-сн3 домены Fс-фрагмента иммуноглобулина g человека Текст научной статьи по специальности «Фундаментальная медицина»

CC BY
340
48
i Надоели баннеры? Вы всегда можете отключить рекламу.
Журнал
Иммунология
Scopus
ВАК
CAS
RSCI
Ключевые слова
РЕКОМБИНАНТНАЯ ПЛАЗМИДНАЯ ДНК / RECOMBINANT PLASMID DNA / FC-ФРАГМЕНТ / FC-FRAGMENT / РЕКОМБИНАНТНЫЕ СН2-СН3 ДОМЕНЫ ИММУНОГЛОБУЛИНА G ЧЕЛОВЕКА / RECOMBINANT CH2-CH3 DOMAINS OF HUMAN IMMUNOGLOBULIN G / ЭКСПРЕССИЯ РЕКОМБИНАНТНЫХ БЕЛКОВ / RECOMBINANT PROTEIN EXPRESSION / МЕТАЛЛОХЕЛЛАТНАЯ ХРОМАТОГРАФИЯ / METAL-CHELATE AFFINITY CHROMATOGRAPHY

Аннотация научной статьи по фундаментальной медицине, автор научной работы — Фомина Елена Георгиевна, Счеслёнок Е.П., Семижон П.А., Школина Т.В., Григорьева Е.Е.

Получен рекомбинантный полипептид, содержащий аминокислотную последовательность СН2-СН3 доменов иммуноглобулина G человека, в клетках Escherichia coli. Показано, что экспрессируемый белок неравнозначно распределён между двумя фракциями бактериального лизата: растворимой (~30%) и нерастворимой (~70%). Отработаны способы его очистки с помощью металлохеллатной хроматографии (растворимая фракция) и выделение «телец включения». Подтверждены антигенные свойства полученного рекомбинантного полипептида в иммуноблоттинге. Наработаны препаративные количества белка, который будет использован в качестве иммуногена для получения иммуноасцитических жидкостей, содержащих моноспецифические поликлональные антитела против IgG человека.

i Надоели баннеры? Вы всегда можете отключить рекламу.

Похожие темы научных работ по фундаментальной медицине , автор научной работы — Фомина Елена Георгиевна, Счеслёнок Е.П., Семижон П.А., Школина Т.В., Григорьева Е.Е.

iНе можете найти то, что вам нужно? Попробуйте сервис подбора литературы.
i Надоели баннеры? Вы всегда можете отключить рекламу.

PRODUCTION, PURIFICATION AND ANTIGENIC SPECIFICITY OF RECOMBINANT POLYPEPTIDE INCLUDING CH2-CH3 DOMAINS OF Fc-FRAGMENT OF HUMAN IMMUNOGLOBULIN G

Recombinant polypeptide containing the amino acid sequence of the CH2-CH3 domains of human immunoglobulin G was produced in Escherichia coli. It was shown that the expressed protein was not equally distributed between two fractions of bacterial lysate: soluble (~ 30%) and insoluble (~ 70%). Methods of protein purification by means of metal-chelate affinity chromatography (soluble fraction) and isolation of “inclusion bodies” have been worked out. The antigenic specificity of the resulting recombinant polypeptide was confirmed in the western blotting analysis. Preparative quantities of protein were produced to be used as an immunogen to obtain immune ascitic fluids containing monospecific polyclonal antibodies against human IgG.

Текст научной работы на тему «Получение, очистка и антигенные свойства рекомбинантного полипептида, включающего сн2-сн3 домены Fс-фрагмента иммуноглобулина g человека»

4. Murdoch D.R., Podmore R.G., Anderson T.P., Barratt K., Maze M.J., French K.E. et al. Impact of Routine Systematic Polymerase Chain Reaction Testing on Case Finding for Legionnaires' Disease: A Pre-Post Comparison Study. Clin. Infect. Dis. 2013; 57(9): 1275-81. doi:10.1093/cid/cit504.

5. NNDSS, Annual Report Writing Group. Australia's notifiable disease status, 2011: annual report of the National Notifiable Diseases Surveillance System. Communicable diseases intelligence quarterly report. 2013; 37(4): E313.

6. Yu V.L., Plouffe J.F., Pastoris M.C., Stout J.E., Schousboe M., Widmer A. et al. Distribution of Legionella Species and Serogroups Isolated by Culture in Patients with Sporadic Community-Acquired Legionellosis: An International Collaborative Survey. J. Infect. Dis. 2002; 186(1): 127-8. doi:10.1086/341087.

7. Kim M.J., Sohn J.W., Park D.W., Park S.C., Chun B.C. Characterization of a lipoprotein common to Legionella species as a urinary broad-spectrum antigen for diagnosis of Legionnaires' disease. J. Clin. Microbiol. 2003; 41(7): 2974-9. doi: 10.1128/jcm.41.7.2974-2979.2003.

8. Shim H.K., Kim J.Y., Kim M.J., Sim H.S., Park D.W., Sohn J.W. et al. Legionella lipoprotein activates toll-like receptor 2 and induces cytokine production and expression of costimulatory molecules in peritoneal macrophages. Exp. Mol. Med. 2009; 41(10): 687. doi:10.3858/emm.2009.41.10.075.

9. Lee S.Y., Rasheed S. A simple procedure for maximum yield of high-quality plasmid DNA. Biotechniques. 1990; 9(6): 676-9.

10. Laemmli U.K. Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature. 1970; 227(5259): 680-5. doi:10.1038/227680a0.

ORIGINAL ARTICLE

11. Bradford M.M. A Rapid and Sensitive Method for the Quantitation of Microgram Quantities of Protein Utilizing the Principle of Protein-Dye Binding. Anal. Biochem. 1976; 72: 248-54. doi:10.1006/ abio.1976.9999.

12. Caligan J.E. Short protocols in immunology. Wiley. 2005; 730.

13. Zurochka A.V., Hajdukov S.V., Kudrjavcev I.V., Chereshnev V.A. Flow cytometry in biology. [Protochnaya tsitomitriya v biologii]. Ekaterinburg: RIO UB RAS; 2014: 576. (in Russian)

14. Ashmarin I.P., Vorob'ev A.A. Statistical methods in microbiological studies. [Statisticheskie metody v mikrobiologicheskikh issledovani-yakh]. Medgiz; 1962. (in Russian)

15. Xia Y., Luan P. Methods and DNA constructs for high yield production of polypeptides. Patent WO. 2003100022; 2003.

16. Amu S., Gjertsson I., Tarkowski A., Brisslert M. B-cell CD25 Expression in Murine Primary and Secondary Lymphoid Tissue. Scand. J. Immunol. 2006; 64(5): 482-92. doi:10.1111/j.1365-3083.2006.01832.x.

17. Godlewska R., Wis'niewska K., Pietras Z., Jagusztyn-Krynicka E.K. Peptidoglycan-associated lipoprotein (Pal) of Gram-negative bacteria: function, structure, role in pathogenesis and potential application in immunoprophylaxis. FEMS Microbiol Lett. 2009; 298(1): 1-11. doi:10.1111/j.1574-6968.2009.01659.x.

18. Shim H.K., Kim J.Y., Kim M.J., Sim H.S., Park D.W., Sohn J.W. et al. Legionella lipoprotein activates toll-like receptor 2 and induces cytokine production and expression of costimulatory molecules in peritoneal macrophages. Exp. Mol. Med. 2009; 41(10): 687. doi:10.3858/emm.2009.41.10.075.

Поступила 03.09.17 Принята в печать 16.12.17

© КОЛЛЕКТИВ АВТОРОВ, 2018 УДК 615.37:547.962.4].012

Фомина Е.Г., Счеслёнок Е.П., Семижон П.А., Школина Т.В., Григорьева Е.Е., Ткачёв С.В., Владыко А.С.

ПОЛУЧЕНИЕ, ОЧИСТКА И АНТИГЕННЫЕ СВОЙСТВА РЕКОМБИНАНТНОГО ПОЛИПЕПТИДА, ВКЛЮЧАЮЩЕГО СН2-СН3 ДОМЕНЫ FС-ФРАГМЕНТА ИММУНОГЛОБУЛИНА G ЧЕЛОВЕКА

Государственное учреждение «Республиканский научно-практический центр эпидемиологии и микробиологии» Министерства здравоохранения Республики Беларусь, 220114, г. Минск, Беларусь

Получен рекомбинантный полипептид, содержащий аминокислотную последовательность СН2-СН3 доменов иммуноглобулина G человека, в клетках Escherichia coli. Показано, что экспрессируемый белок неравнозначно распределён между двумя фракциями бактериального лизата: растворимой (~30%) и нерастворимой (~70%). Отработаны способы его очистки с помощью металлохеллатной хроматографии (растворимая фракция) и выделение «телец включения». Подтверждены антигенные свойства полученного рекомбинантного полипептида в иммуно-блоттинге. Наработаны препаративные количества белка, который будет использован в качестве иммуногена для получения иммуноасцитических жидкостей, содержащих моноспецифические поликлональные антитела против IgG человека.

Ключевые слова: рекомбинантная плазмидная ДНК; Fc-фрагмент; рекомбинантные СН2-СН3 домены иммуноглобулина G человека; экспрессия рекомбинантных белков; металлохеллатная хроматография.

Для цитирования: Фомина Е.Г., Счеслёнок Е.П., Семижон П.А., Школина Т.В., Григорьева Е.Е., Ткачёв С.В., Владыко А.С. Получение, очистка и антигенные свойства рекомбинантного полипептида, включающего СН2-СН3 домены Fc-фрагмента иммуноглобулина G человека. Иммунология. 2018; 39(1): 55-61. DOI: http://dx.doi.org/10.18821/0206-4952-2018-39-1-55-61

Fomina E.G., Scheslenok E.P., Semizhon P.A., Shkolina T.V., Grigorieva E.E., Tkachov S.V., Vladyko A.S. PRODUCTION, PURIFICATION AND ANTIGENIC SPECIFICITY OF RECOMBINANT POLYPEPTIDE INCLUDING CH2-CH3 DOMAINS OF FC-FRAGMENT OF HUMAN IMMUNOGLOBULIN G

State Institution «The Republican Research and Practical Center for Epidemiology and Microbiology», Ministry of Health of the Republic of Belarus, 220114, Minsk, Belarus

Для корреспонденции: Фомина Елена Георгиевна, ведущий научный сотрудник лаборатории биотехнологии и иммунодиагностики особо опасных инфекций государственного учреждения «Республиканский научно-практический центр эпидемиологии и микробиологии», кандидат биологических наук. E-mail: feg1@tut.by

ОРИГИНАЛЬНЫЕ СТАТЬИ

Recombinant polypeptide containing the amino acid sequence of the CH2-CH3 domains of human immunoglobulin G was produced in Escherichia coli. It was shown that the expressed protein was not equally distributed between two fractions of bacterial lysate: soluble (~ 30%) and insoluble (~ 70%). Methods of protein purification by means of metal-chelate affinity chromatography (soluble fraction) and isolation of "inclusion bodies" have been worked out. The antigenic specificity of the resulting recombinant polypeptide was confirmed in the western blotting analysis. Preparative quantities of protein were produced to be used as an immunogen to obtain immune ascitic fluids containing monospecific polyclonal antibodies against human IgG.

Keywords: recombinant plasmid DNA; Fc-fragment; recombinant CH2-CH3 domains of human immunoglobulin G; recombinant protein expression; metal-chelate affinity chromatography.

For citation: Fomina E.G., Scheslenok E.P., Semizhon P.A., Shkolina T. V., Grigorieva E.E., Tkachov S.V., Vladyko A.S. Production, purification and antigenic specificity of recombinant polypeptide including CH2-CH3 domains of Fc-fragment of human immunoglobulin G. Immunologiya. 2018; 39(1): 55-61. DOI: http://dx.doi.org/10.18821/0206-4952-2018-39-155-61

For correspondence: Fomina Elena Georgievna, lead researcher of the laboratory of biotechnology and immunodiagnostic of very dangerous infections The Republican Research and Practical Center for Epidemiology and Microbiology. E-mail: feg1@tut.by

Information about authors:

Fomina E.G., https://orcid.org/0000-0003-4664-4752; Scheslenok E.P., https://orcid.org/0000-0001-8143-684X; Semizhon P.A., https://orcid.org/0000-0001-7986-8299; Shkolina T.V., https://orcid.org/0000-0003-1135-0981; Grigorieva E.E., https://orcid.org/0000-0003-3919-0625; Tkachov S.V., https://orcid.org/0000-0002-5674-4004; Vladyko A.S., https://orcid.org /0000-0001-6927-5043.

Conflict of interest. The authors declare no conflict of interest. Acknowledgments. The work was carried out with the financial support of the State Committee on Science and Technology of the Republic of Belarus in the framework of the project «Working out technology and development ofproduction of polyclonal antihuman IgG and IgM antibodies, specific to Fc fragments of heavy chains, for use in diagnostic purposes» within subprogram 8 «Import-substituting diagnostic tools and biopreparations-2020» of the State program «Science intensive technologies and technique» for 2016-20 years.

Received 19.06.17 Accepted 16.08.17

Введение

Современные успехи в технологии рекомбинантных ДНК дают возможность получать и использовать в терапевтических, диагностических, научных целях отдельные компоненты (цепи, домены, фрагменты) молекулы иммуноглобулинов человека. Строение иммуноглобулинов как дискретных белковых доменов, определяющих антигенную специфичность (Fab-фрагмент) и эффекторные функции (Fc-фрагмент), соответственно, является основой для биосинтеза этих субфрагментов как отдельных белков. Ряд из них, таких как Fv, Fab, Fd, scFv и Fc, были экспрессированы с использованием прокариотических систем экспрессии [1]. Демонстрация возможности получения биологически активных фрагментов иммуноглобулинов в простой при использовании и дешёвой системе E. coli привела к появлению заметного интереса к этим исследованиям и синтезу большого количества «химерных» белков, используемых в диагностике и терапии [1]. Тем не менее, для создания целого ряда белков, объединённых общим названием иммуноадгезинов и иммуноконъюгатов, где Fc-фрагмент был использован как <^шюп»-партнёр с другими протеинами, предпочтение было отдано эукариоти-ческой системе как обеспечивающей процесс гликозилирова-ния, необходимого для активации комплемента [1].

Особый интерес представляет использование Fc-фрагмента и его составных частей в качестве антигена для получения антител как основы иммуноферментных конъ-югатов различной специфичности. Известно, что гипериммунные антисыворотки к пулу иммуноглобулинов, которые, как правило, служат сырьём для производства антивидовых иммуноферментных конъюгатов, могут давать нежелательные перекрестные реакции из-за наличия общих антигенных структур у иммуноглобулинов человека и различных видов животных. Использование в качестве конъюгатов меченых антител из антисывороток к отдельным классам иммуногло-

булинов также не гарантирует специфичность, прежде всего из-за присутствия общих антигенных детерминант у разных изотипов иммуноглобулинов одного и того же вида. Решение данной проблемы возможно за счёт изменения дизайна рекомбинантного иммуногена: включение в его состав отдельных линейных эпитопов молекулы иммуноглобулина и исключение неиммуногенных сайтов.

Целью настоящего исследования было оценить возможность биосинтеза в клетках E.coli рекомбинантного полипептида, содержащего СН2-СН3 домены иммуноглобулина G человека, отработать методы его очистки и оценить антигенные свойства.

Материал и методы

Бактериальные штаммы и клеточные линии. Бактериальный штамм XL-blue (recA1 endA1 gyrA96 thi-1 hsdR17 supE44 relA1 lac [F' proAB laclq AlacZ(M15)]) использовали для проведения генно-инженерных работ, штамм BL21(DE3) (F-ompT hsdS(rB- mB-) gal dcm X(DE3)) - для получения рекомбинантного полипептида после индукции изопропил-ß-D-1-тиогалактопиранозидом (ИПТГ). Клеточная линия IM-9 была использована как источник РНК для получения кДНК фрагментов СН2-СН3 доменов иммуноглобулина G человека.

Выделение РНК и ОТ-ПЦР. Выделение РНК проводилось с использованием коммерческого препарата TRI Reagent BD (Sigma) согласно инструкции по применению.

Реакцию обратной транскрипции с последующей ПЦР осуществляли с использованием набора реагентов OneStep RT-PCR Kit (Qiagen) в соответствии с рекомендациями производителя. Нуклеотидные последовательности, соответствующие выбранным Fc-фрагментам иммуноглобулинов G, анализировались в базах данных GenBank, European Nucleotide Archive, Uniprof.

Праймеры для амплификации СН2-СН3 доменов Fc-

- se -

ORIGINAL ARTICLE

фрагмента иммуноглобулина G (Праймтех, Беларусь) имеют следующую нуклеотидную последовательность: IgG прямой (5'-CGCGAAGCTTCCGTGCCCA GCACCT-3'); IgG обратный (3'-GC GCCTCGAGTTTACCCGGAGAC AG-5') и содержат сайты узнавания для HindIII и XhoI рестриктаз (отмечены подчёркиванием), которые необходимы для последующего клонирования фрагментов в экс-прессирующий вектор pJC40 [2].

Анализ продуктов амплификации проводили в 1,5%-ном агароз-ном геле. В качестве электродного буфера использовали 1х ТВЕ. Для визуализации анализируемой ДНК гели окрашивали раствором бромистого этидия в конечной концентрации 1,0 мкг/мл.

Конструирование экспрессирую-щего вектора. В качестве экспрес-сирующего вектора использовали плазмиду pJC40

Рис. 1, а - Схематическое изображение плазмидного вектора pJC40; б - рестрикционный анализ рекомбинантной плазмиды pJC40/IgG (СН2-СН3) и исходного вектора, п. н.

1 - амплификат, полученный с парой праймеров, ограничивающих СН2-СН3 область иммуноглобулина G; 2 - маркер молекулярных масс (1kb Ladder, Thermo Scientific, США); 3 - рестрикция вектора pJC40 по HindIII сайту; 4 - рестрикция рекомбинантной плазмиды по HindIII сайту, 5 - рестрикция рекомбинант-обеспечивающую ной плазмиды по HindIII и XhoI сайтам рестрикции.

транскрипцию клонированных генов в бактериальных клетках под контролем Т7-промотора. Особенностью этой плазмиды является наличие дополнительного фрагмента, кодирующего десять остатков гистиди-на, которые при трансляции локализуются в N-концевой части рекомбинантного полипептида, что позволяет очистить данный рекомбинантный полипептид с помощью аффинной металлохеллатной хроматографии.

Рестрикцию вектора и амплифицированных фрагментов проводили ферментами HindIII и XhoI (Thermo Scientific, США) согласно инструкции производителя. Для лигирова-ния использовали фермент T4 ДНК-лигаза того же производителя. Полученной лигазной смесью трансформировали компетентные клетки E.coli, штамм XL-blue.

Трансформацию бактериальных клеток выполняли с использованием CaCl2, как описано в руководстве по молекулярному клонированию [3]. Трансформанты высевали на селективную среду, содержащую ампициллин (50 мкг/мл). Клоны, полученные после трансформации лигазной смесью, рассева-ли штрихом и выделяли из них плазмидную ДНК с использованием коммерческого набора QIAprep Mrniprep Kit (Qiagen).

Секвенирование нуклеотидных последовательностей проводили с помощью Big Dye Terminator v 3.1 Cycle Sequencing Kit (Applied Biosystems) согласно инструкции по применению. Электрофорез и анализ продуктов реакции выполняли на автоматическом капиллярном ДНК-анализаторе ABI PRISM 3100 (Applied Biosystems, США). Выравнивание нуклеотидных последовательностей проводили с использованием программы MEGA 4,0. Для поиска последовательностей, гомологичных выявленным фрагментам ДНК, использовали BLAST (Basic Local Alignment Search Tool).

Индукция синтеза рекомбинантного белка. Клетки E. coli, штамм BL21 (DE3), трансформированные плазмидой, выращивали при 37оС в питательной среде LB с ампициллином (50 мкг/мл) при постоянном шейкировании до достижения культурой логарифмической фазы роста (0D600 = 0,3). Добавляли в среду ИПТГ в конечной концентрации 0,4 mM и инкубировали в течение 3 ч. Клетки собирали центрифугированием, анализировали бактериальный лизат электрофорезом в полиакриламидном геле по методу U. Laemmli [4]. Концентрация разделяющего геля составляла 15%, концентрирующего - 6%. Белки разделяли при напряжении 200 В в течение 1 ч. После окончания электрофореза гель окрашивали раствором Кумасси R-250.

Аффинную хроматографию проводили на HisBind колонке (Sigma) с иммобилизованными катионами Ni2+ в денатурирующих условиях (все используемые буферные растворы содержали 6 М мочевину). Для приготовления лизата клетки E. coli (100 мл бактериальной культуры) осаждали центрифугированием при 5000 об/мин. в течение 10 мин. Супернатант удаляли, и осадок ресуспендировали в 1 мл холодного 1x «Bind» буфера (5мМ имидазол, 0,5М NaCl, 20мМ трис-HCl, рН 7,9). Затем клеточную суспензию обрабатывали четырежды ультразвуком при 20 кГц в течение 20 с на льду. После обработки ультразвуком клеточные лизаты E.coli выдерживали в течение 1 ч в растворе, содержащем 6 М мочевину, и затем центрифугировали при 6000 об/мин. Супернатант, содержащий растворимые белки, собирали и наносили на колонку со скоростью 15-20 мл/час. После нанесения материала колонку отмывали 10 объёмами связывающего «Bind» буфера и 5 объёмами отмывочного «Wash» буфера (20мМ имидазол, 0,5М NaCl, 20мМ трис-HCl, рН 7,9). Элюцию связавшихся на колонке рекомбинантных полипептидов проводили 5 объёмами элю-ирующего «Elute» буфера (300 мМ имидазол, 0,5М NaCl, 20мМ трис-HCl, рН 7,9). Фракции элюции и все остальные фракции хроматографии анализировали электрофорезом в 15% ПААГ. Количество белка рассчитывали относительно маркера молекулярных масс.

Иммуноблоттинг. Для постановки иммунного блоттинга осуществляли электроперенос белков из 15%-ного полиа-криламидного геля на нитроцеллюлозную мембрану (Sigma, размер пор 0,2 мкм) с использованием прибора Criterion Blotter (BioRad, США). Полоски нитроцеллюлозной мембраны с иммобилизованными белками (стрипы) выдерживали

2 ч в фосфатно-солевом буферном растворе (ФСБ), рН 7,2, содержащем 3% бычьего сывороточного альбумина (БСА), для блокирования неспецифических мест связывания. Затем инкубировали стрипы со специфическим конъюгатом в течение 2 ч при постоянном покачивании. Далее отмывали стрипы буфером ФСБ, содержащим 0,05% Твин 20 (ФСБ-Т),

3 раза по 5 мин и погружали в раствор антивидового перок-сидазного конъюгата, приготовленного на ФСБ, содержащем 0,05% Твин 20 и 1% БСА (ФСБ-Т-БСА), на 1 ч. После отмывки стрипы помещали в раствор субстрата, в качестве которого использовали диаминобензидин, растворенный в ФСБ, рН 7,2, содержащем 0,3%-ную перекись водорода. После

ОРИГИНАЛЬНЫЕ СТАТЬИ

развития окраски реакцию останавливали, отмывая стрипы трижды дистиллированной водой.

Результаты и обсуждение

Несмотря на накопленные знания в области генетики и молекулярной биологии E. coli, существует ряд причин неэффективной экспрессии клонированных генов: структурные особенности кодирующей последовательности; стабильность и эффективность трансляции мРНК; некорректный фолдинг молекул полипептида и вследствие этого деградация его протеазами клетки-хозяина; существенные различия в используемых кодонах между «привнесённым» геном и «нативными» E. coli; потенциальная токсичность белка для клетки-хозяина. Оценить влияние этих факторов можно только экспериментально. Интересным, на наш взгляд, является возможность экспрессии рекомбинантного СН2-СН3 домена Fc-фрагмента в прокариотической системе как альтернативы цельным иммуноглобулинам для получения антисывороток к IgG человека.

Для биосинтеза рекомбинантного полипептида использовали бактериальный штамм BL21 (DE3) и экспрессирующий вектор pJC 40. Этот плазмидный вектор широко используется для эффективной и специфической суперэкспрессии клонированных генов под контролем Т7 РНК-полимеразы. Количество экспрессируемого рекомбинантного белка может составлять до 10% от тотального клеточного. Вектор содержит «гистидиновый хвост», который становится составляющей частью N-конца экспрессируемого белка. Наличие последовательности, кодирующей 10 остатков гистидина, позволяет осуществлять очистку рекомбинантного полипептида аффинной металлохеллатной хроматографией.

Нуклеотидная последовательность, кодирующая СН2-СН3 домены иммуноглобулина класса G, амплифицирована c помощью обратной транскрипции-полимеразной цепной реакции (ОТ-ПЦР). В качестве матрицы использована РНК, выделенная из клеток лимфобластомы IM-9. ОТ-ПЦР проводили с использованием специфических праймеров, в состав которых дополнительно включены сайты для узнавания HindIII и XhoI рестриктазами (согласно наиболее близкой

(прототипной) нуклеотидной последовательности, представленной в GenBank (JX292764.2), клонируемый фрагмент не содержит сайтов для распознавания указанными рестрикта-зами).

При анализе амплификатов в агарозном геле идентифицирован ПЦР-продукт, имеющий размер 680 п. н., который был обработан ферментами рестрикции, очищен и использован для клонирования в полилинкер экспрессирующего вектора. Таким образом, в результате стандартных генно-инженерных манипуляций получена рекомбинантная плазмидная ДНК pJC40/IgG (СН2-СН3), включающая часть Fc-фрагмента тяжёлой цепи иммуноглобулина G человека. На рис. 1 представлены циркулярная карта экспрессирующего вектора и результаты рестрикционного анализа рекомбинантной плаз-миды. Результат рестрикции по уникальному сайту показал, что рекомбинантная плазмидная ДНК, содержащая вставку, менее подвижна в агарозном геле, чем исходный вектор, при этом обработка рестриктазами HindIII и XhoI делит её на 2 фрагмента, один из которых аналогичен вектору (2402 п. н.), второй - клонированной вставке (660 п. н.).

Для подтверждения специфичности вставки определена нуклеотидная последовательность клонированного фрагмента методом секвенирования с использованием Big Dye Terminator v 3.1 Cycle Sequencing Kit (Applied Biosystems). Анализ показал практически полную гомологию нуклеотидов с матричной РНК, кодирующей тяжёлую цепь иммуноглобулина G человека, и выявил миссенс-мутацию (трансверсия С^А в положении 121, приводящая к замене аминокислоты H^N (histidine^asparagine)). Анализ данных литературы показал, что обнаруженная мутация, вероятно, не затрагивает функционально значимых доменов Fc-фрагмента молекулы иммуноглобулина. На рис. 2 представлена аминокислотная последовательность полученного полипептида с выделением перекрывающихся линейных антигенных детерминант, на которые, согласно данным литературы, вырабатываются антитела в ответ на иммунизацию мышей целой молекулой IgG. Большинство из них локализовано в Fc-фрагменте IgG [5].

Картирование эпитопов моноклональными антителами (мАТ, pepscan analysis) выявило последовательности

GenPeptGraphics

Fc IgGl heavy chain constant region, partial [Homo sapiens] Sequence ED: AEV43323.1 Length: 232 Number of Matches: 1

Soccc Expect Method Identities Positives Gaps

452 bits (1164) 4e-161 Compositional matrix adjust. 219220 (99%) 220220 (100%) 0220(0%)

Query 1

Sbjct 13

Query 61

Sbjct 73

Query 121

Sbjct 133

Query 181

Sbjct 193

PC PAPE LLGGPSVFLF PPKPKDTI24I SRT PEVTCVWDVSNEDPEVKFNWYVDGVEVHNA 60 PCPAPELLGGPSVFLFPPKPKDTIMSRTPEVTCVVVDVS+E^^

PC PAPE LLGGPS VFLF PPK PKD TT2"H SRT PEVTCWVDVSHE D PEVKFNWYVDGVEVHNA 72

KTKPI^EQYNSTYRWSVLTVLHQDWI2^KEYKQCVSNKALPAPIEKTI SKAKGQPREPQ 120 KTKPREEQYNST YRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIElCri SKAKGQPREPQ

KTKPREEQYNST YKWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQ 132

VYTLPP SREEMTKNQVSLTCLVKGFY PSD IAVEWESNGQPENNYKTTPPVID SPG SFFLY

SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Рис. 2. Аминокислотная последовательность клонированного фрагмента с обозначением линейных эпитопов.

-<— 32

30—►

25—>■

20—>■

12 3 4

Рис. 3. Оценка экспрессии рекомбинантного полипептида, содержащего аминокислотные последовательности СН2-СН3 участка Fc-фрагмента тяжёлых цепей иммуноглобулина человека класса G, в клетках E. coli, штамм BL21 (DE3) электрофорезом в ПААГ, кДа. 1 - маркер молекулярных масс (Thermo Scientific, США); 2, 3 - лизат бактериальных клеток без индукции ИПТГ; 4 - лизат бактериальных клеток после индукции ИПТГ.

290-К^га!Е-294 и 338-KAKGQPR-344, расположенные соответственно в СН2 домене и ^регионе СН3 домена и присутствующие у всех четырех классов IgG [6]. Анализ т siUco, проведённый в работе [7], показал, что аминокислотный фрагмент 290-KpREEQYN-297 обладает выраженной гидрофильностью и, вероятно, является наиболее антигенным участком СН2 домена. Также известно, что участок 383-SNGQPENN-390 выявляется пан-специфичными мАТ у всех подклассов IgG [8].

Для экспрессии рекомбинантного белка полученной гибридной плазмидой pJC40IgG(СН2-СН3) трансформировали бактериальную культуру компетентных клеток Е.соИ, штамм BL21 (ЭЕ3). Эффективность экспрессии оценивали по интенсивности соответствующих зон при электрофорезе в полиакриламидном геле (теоретически рассчитанная молекулярная масса получаемого белка составляла 32 кДа). Оптимизация условий получения рекомбинантного полипептида по таким параметрам, как температура культивирования, количество индуктора в среде и время индукции, позволила достигнуть высокой продукции белка. Максимальное количество рекомбинантного белка экспрессировалось при внесении в среду культивирования ИПТГ в конечной концентрации 0,4 тМ в момент достижения клеточной культурой оптической плотности OD600 = 0,3 и дальнейшей инкубации в течение 3 ч.

В лизате продуцента наблюдалось присутствие мажорного белкового продукта, размер которого по данным электрофореза составлял 32 кДа, что совпадало с теоретически

ORIGINAL ARTICLE

iНе можете найти то, что вам нужно? Попробуйте сервис подбора литературы.

рассчитанной массой ожидаемого рекомбинантного полипептида (рис. 3).

Известно, что некоторые рекомбинантные белки при экспрессии их в гетерологичных системах способны на неспецифическую агрегацию (формирование так называемых «телец включения»). Интересно отметить, что анализ «грубых лизатов» бактерий-продуцентов после обработки ультразвуком и осаждения центрифугированием показал, что белок с молекулярной массой 32 кДа определяется одновременно в двух фракциях: растворимой и нерастворимой, причём основная часть полипептида (70%) присутствует в виде «телец включения» (рис. 4, дорожки 2 и 4).

Тем не менее, представлялось интересным определить, какое количество белка можно элюировать из бактериального лизата, используя металлохеллатную хроматографию, основанную на взаимодействии N-концевых гистидиновых остатков рекомбинантного полипептида с иммобилизованными на матриксе ионами никеля.

Аффинную хроматографию проводили в денатурирующих условиях, при которых полигистидиновый кластер полностью экспонирован на поверхности молекулы, что приводит к наиболее эффективному специфическому связыванию его с ад-

-ES*

1 2 3 4

Рис. 4. Оценка распределения рекомбинантного белка в растворимой и нерастворимой (в виде «телец включения») фракциях бактериального лизата, кДа.

1 - «грубый лизат» бактериальной биомассы продуцента; 2 - бактериальные клетки, обработанные ультразвуком; растворимая фракция (надосадок); 3 - маркёр молекулярных масс (Thermo Scientific, США); 4 - клетки продуцента после обработки ультразвуком и осаждения; нерастворимая фракция (осадок); окрашивание Кумасси R-250.

ОРИГИНАЛЬНЫЕ СТАТЬИ

32-

-40

-30

-25

Рис. 5. Электрофоретический анализ фракций металлохеллат-ной хроматографии рекомбинантного полипептида, включающего участки иммуноглобулина G человека, кДа.

1 - 3 - лизат бактерий-продуцентов до обработки (1), после обработки ультразвуком и мочевиной (2), после нанесения на колонку (3); 4, 5 - фракции отмывки колонки после сорбции; 6, 7 - фракции элюции; 8 - маркёр молекулярных масс (Thermo Scientific, США); окрашивание Кумасси R-250.

сорбентом и высокой степенью очистки полипептида. С целью дезинтеграции полипептидов клеточную суспензию обрабатывали четырежды ультразвуком при 20 кГц в течение 20 с на льду и выдерживали в течение 1 ч в растворе с 6М мочевиной. На рис. 5 представлен электрофоретический анализ фракций ме-таллохелатной хроматографии рекомбинантного полипептида.

Из рис. 5 видно, что фракции элюции (дорожки 6 и 7) содержат белок, соответствующий рассчитанной молекулярной массе (32 кДа) рекомбинантного полипептида. Незначительное количество фоновых клеточных белков во фракциях элюции позволяет сделать вывод о высокой степени очистки белка (~90%).

Поскольку растворимая фракция бактериального лизата включает незначительную часть рекомбинантного полипеп-

30-

ты L—

-40

30

-25

Рис. 6. Очистка «телец включения» рекомбинантного полипептида, кДа.

1 - 6 - фракции (осадок, надосадок) после последовательной обработки ультразвуком и центрифугирования; 7 - маркёр молекулярных масс (Thermo Scientific, США); 8 - растворимая фракция; 9 - «тельца включения» (после 4-кратной обработки лизата ультразвуком и осаждения центрифугированием); окрашивание Кумасси R-250.

■I

-32 -23

1

2

3

4

5

6

7

8

9

Рис. 7. Оценка антигенной специфичности рекомбинантного полипептида в иммуноблоттинге, кДа.

1 - маркёр молекулярных масс (Thermo Scientific, США); 2, 6 - лизат бактериальных клеток продуцента; 3, 7 - «тельца включения» рекомбинантного полипептида; 4, 8 - коммерческий препарат цельных иммуноглобулинов G; 5, 9 - лизат клеток BL21(DE3); нитроцеллюлозные мембраны 2 - 5 инкубированы с анти-G конъюгатом, мембраны 6 - 9 -с анти-М антителами, меченными пероксидазой хрена.

тида (см. рис. 5, дорожка 2), что не позволяет получать его в препаративных количествах с помощью металлохеллатной хроматографии, для наработки очищенного препарата была использована нерастворимая фракция биомассы бактерий-продуцентов. Очистку рекомбинантного полипептида в виде «телец включения» проводили поэтапным многократным (не менее четырёх раз) «озвучиванием» материала при 20 кГц с последующим центрифугированием. В результате проведённых исследований получен очищенный рекомбинантный полипептид в препаративных количествах (1500 мкг в расчёте на 100 мл исходной культуры бактерий-продуцентов) (рис. 6).

Так как выделение «телец включения» рекомбинант-ной иммуноглобулиновой фракции не является специфическим методом очистки, то было принципиально важно оценить антигенную специфичность очищенного нерастворимого полипептида в иммуноблоттинге. В качестве антигенов, иммобилизованных на мембране, использовали: лизат бактерий-продуцентов после индукции ИПТГ, очищенные «тельца включения», коммерческий препарат иммуноглобулина G и лизированные клетки BL21 (DE3) (отрицательный контроль) (конъюгатами служили антитела к иммуноглобулинам G и М человека, меченные пероксидазой хрена). Данные представлены на рис. 7. Специфически окрашенные полосы наблюдаются в области 32 кДа только в препаратах, содержащих лизат бактерий-продуцентов (см. рис. 7, дорожка 2) и очищенные «тельца включения» (см. рис. 7, дорожка 3), а также в зонах 23 и 55 кДа - препарата коммерческих иммуноглобулинов G (см. рис. 7, дорожка 4), инкубированных с конъюгатом, содержащим анти-G антитела. Рекомбинантный полипептид не взаимодействует с анти-М антителами (см. рис. 7, дорожки 6 - 9), что является подтверждением наличия в полученном полипептиде линейных эпитопов, специфически взаимодействующих исключительно с антителами против иммуноглобулинов G человека.

Заключение

В статье показана возможность получения препаративных количеств рекомбинантного полипептида, содержащего СН2-СН3 участки Fc-фрагмента тяжёлых цепей иммуноглобулина человека класса G, в клетках E. coli и доказана его специфичность. Полученный препарат может быть использован в качестве антигена для иммунизации животных (лабораторных мышей) с целью получения асцитических жид-

85

60 50 40

55

30 25

20

2

3

4

5

6

7

S

2

3

4

5

6

7

9

костей, содержащих класс специфические поликлональные антитела против IgG человека.

Финансирование. Работа выполнена при финансовой поддержке Государственного комитета по науке и технологиям Республики Беларусь в рамках выполнения задания «Разработка технологии и освоение производства препарата антивидовых иммуноглобулинов к IgG и IgM человека, специфичных к Fc-фрагментам тяжёлых цепей, для использования в диагностических целях» подпрограммы 8 «Импортозамещающие диагностикумы и биопрепараты - 2020» Государственной программы «Наукоёмкие технологии и техника» на 2016 - 2020 годы.

Конфликт интересов. Авторы заявляют об отсутствии конфликта интересов.

ЛИТЕРАТУРА (REFERENCES)

1. Rönnmark J., Hansson M., Nguyen T., Uhlen M., Robert A., Stähl S. et al. Construction and characterization of affibody-Fc chimeras produced in Escherichia coli. J. Immunol. Methods. 2002; 261(1-2): 199-211.

REVIEWS

2. Clos J., Brandau S. pJC20 and pJC40 - two high-copy-number vectors for T7 RNA polymerase-dependent expression of recombinant genes in Escherichia coli. Protein Expr. Purif. 1994; 5: 133-7.

3. Sambrook J., Russell D. Molecular Cloning: a Laboratory Manual : in 3 vol. 3rd Ed. New York: Cold Spring Harbor Laboratory Press; 2001.

4. Laemmli U. Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature. 1970; 227(5259): 680-5.

5. Novotny J., Handschumacher M., Haber E. Location of antigenic epitopes on antibody molecules. J. Mol. Biol. 1986; 189: 715-21.

6. Nelson P., Westwood O., Soltys A. et al. Characterization of epitopes of pan-IgG/anti-G3m(u) and anti-Fc monoclonal antibodies. Immunol. Lett. 2003; 88: 77-83.

7. Hajighasemi F., Shokri F. Production and characterization of mouse monoclonal antibodies recognizing multiple subclasses of human IgG. Avicenna. J. Med. Biotech. 2010; 2(1): 37-45.

8. Nelson N., Westwood O., Jefferis R. et al. Characterization of anti-IgG monoclonal antibody A57H by epitope mapping. Biochem. Soc. Transact. 1997; 25 (2): 373.

Поступила 19.06.17 Принята в печать 16.08.17

ОБЗОРЫ

© ВЛАДИМИРСКИЙ М.А., 2018

УДК 616-002.5-053.2-092:612.017.1]-078.33

Владимирский М.А.

ИММУНОЛОГИЧЕСКИЕ МЕТОДЫ ДИАГНОСТИКИ ТУБЕРКУЛЁЗНОЙ ИНФЕКЦИИ У ДЕТЕЙ И ПОДРОСТКОВ. ПРОБЛЕМЫ И ПЕРСПЕКТИВЫ.

ФГАОУ ВО Первый Московский государственный медицинский университет им. И.М. Сеченова, Министерства здравоохранения РФ, 119991, Москва; НИИ фтизиопульмонологии, 127994, Москва, Россия

Величина распространения латентной туберкулёзной инфекции - 2,3 млрд людей. Чрезвычайное значение для человечества - ликвидировать туберкулёз как распространённое заболевание к 2035 г Для детского населения, в силу ограниченности применения методов лучевой диагностики, основными массовыми методами на сегодня являются иммунологические тесты определения туберкулёзной инфекции. Наиболее распространённый метод кожной туберкулиновой пробы (р. Манту) в связи с её недостаточной специфичностью имеет существенные недостатки, особенно в странах, использующих массовую БЦЖ-вакцинацию. Относительно новые методы с использованием специфических рекомбинантных белков МБТ как в тестах in vitro, так и в новых кожных тестах позволяют значительно более точно определить туберкулёзное инфицирование в латентной или активной форме, однако они менее чувствительны по сравнению с пробой Манту, что требует развития этих методов с введением новых дополнительных специфических антигенов. Несомненно, что разработка новых методов дифференцирования активной и латентной туберкулезной инфекции или прогностических методов перехода латентной инфекции к прогрессиро-ванию в активную стадию является одной из наиболее актуальных задач в борьбе с туберкулёзом. В настоящем обзоре демонстрируются также новые методы исследований клеток крови и образцов плазмы крови, основанные на применении проточной цитофлуориметрии с детекцией антиген-специфичных Т-клеток, продуцирующих интерферон-гамма и фактор некроза опухолей альфа, специфических Т-клеточных маркеров, а также использовании комбинаций определения различных белковых факторов, которые имеют перспективу определения признаков активной туберкулёзной инфекции. Однако эти методы пока трудозатратны и дорогостоящи. Развиваются новые перспективные подходы к определению специфических антител в сыворотке крови, основанные на использовании новых генно-инженерных продуктов. При развитии ускоренных методов анализа экспрессии специфических генов в клетках крови это направление также имеет перспективу внедрения в практику здравоохранения. Обзор проведён по базам данных Medline (PubMed) и РИНЦ.

Ключевые слова: туберкулёзная инфекция; кожные тесты; иммунодиагностика; цитокины; антитела; экспрессия генов.

Для корреспонденции: Владимирский Михаил Александрович, д-р мед. наук, проф., зав. лабораторией иммунологических исследований и молекулярной диагностики туберкулёза, E-mail: mvladimirskij@mail.ru

i Надоели баннеры? Вы всегда можете отключить рекламу.