Научная статья на тему 'ОСОБЕННОСТИ МАСС-СПЕКТРОМЕТРИЧЕСКОЙ ДЕТЕКЦИИ БЕТА-АМИЛОИДНЫХ ПЕПТИДОВ (ПЕПТИДОВ АЛЬЦГЕЙМЕРА)'

ОСОБЕННОСТИ МАСС-СПЕКТРОМЕТРИЧЕСКОЙ ДЕТЕКЦИИ БЕТА-АМИЛОИДНЫХ ПЕПТИДОВ (ПЕПТИДОВ АЛЬЦГЕЙМЕРА) Текст научной статьи по специальности «Химические науки»

CC BY
33
8
i Надоели баннеры? Вы всегда можете отключить рекламу.
Журнал
Научное приборостроение
ВАК
RSCI
Область наук
Ключевые слова
КОЛИЧЕСТВЕННАЯ МАСС-СПЕКТРОМЕТРИЯ / БЕТА-АМИЛОИДЫ / α-2-МАКРОГЛОБУЛИН

Аннотация научной статьи по химическим наукам, автор научной работы — Миргородская О. А., Протасов А. В., Козьмин Ю. П., Бубляев Ростислав Анатольевич, Гобом Й.

Масс-спектрометрия в сочетании с использованием изотопно-меченных стандартов является одним из популярных методов количественного измерения концентрации бета-амилоидов в биологических средах. Данная статья посвящена предупреждению типичных систематических ошибок таких измерений, возникающих вследствие пренебрежения возможностью превращения бета-амилоидов в денатурированную форму, которая дает в масс-спектрах сигналы в 3 раза более интенсивные, чем нативная форма. Степень этой денатурации определялась по способности нативной формы образовывать комплекс с α-2-макроглобулином, чего денатурированная форма лишена. Показано, что денатурация может происходить при нагревании в кислой среде или при использовании диметилсульфоксида в качестве растворителя. Ошибка измерения возникает, когда изотопно-меченный стандарт и аналит относятся к разным формам. Предложены рекомендации для преодоления систематических ошибок количественного анализа этих соединений посредством принудительной денатурации смеси аналита со стандартом перед анализом.

i Надоели баннеры? Вы всегда можете отключить рекламу.

Похожие темы научных работ по химическим наукам , автор научной работы — Миргородская О. А., Протасов А. В., Козьмин Ю. П., Бубляев Ростислав Анатольевич, Гобом Й.

iНе можете найти то, что вам нужно? Попробуйте сервис подбора литературы.
i Надоели баннеры? Вы всегда можете отключить рекламу.

FEATURES OF MASS SPECTROMETRIC DETECTION BETA-AMYLOID PEPTIDES (ALZHEIMER'S PEPTIDES)

Mass spectrometry combined with the use of isotope-labeled standards is one of the favored methods for the quantitative measurement of beta-amyloid concentrations in biological media. This article is devoted to the prevention of typical systematic errors in such measurements arising from the neglect of the possibility of beta-amyloid transformation into the denatured form, which gives in mass spectra signals three times more intensity than the native form. The degree of this denaturation was determined by the ability of the native form to set up a complex with α-2-macroglobulin. The denatured form lacks this point. It was shown that denaturation can occur in the case of heat treatment in an acidic environment or when DMSO is used as a solvent. Measurement error occurs when the isotope-labeled standard and the analyte are of different forms. There are suggested recommendations to overcome systematic errors in the quantitative analysis of these compounds by forcing denaturation of the mixture of the analyte with the standard before analysis.

Текст научной работы на тему «ОСОБЕННОСТИ МАСС-СПЕКТРОМЕТРИЧЕСКОЙ ДЕТЕКЦИИ БЕТА-АМИЛОИДНЫХ ПЕПТИДОВ (ПЕПТИДОВ АЛЬЦГЕЙМЕРА)»

ISSN 0868-5886 НАУЧНОЕ ПРИБОРОСТРОЕНИЕ, 2022, том 32, № 4, c. 35-48

- ПРИБОРОСТРОЕНИЕ ДЛЯ БИОЛОГИИ =

И МЕДИЦИНЫ

УДК543.51: 577.1: 66.096.3

© О. А. Миргородская, А. В. Протасов, Ю. П. Козьмин, P. А. Бубляев, Й. Гобом, 2022

ОСОБЕННОСТИ МАСС-СПЕКТРОМЕТРИЧЕСКОЙ ДЕТЕКЦИИ БЕТА-АМИЛОИДНЫХ ПЕПТИДОВ (ПЕПТИДОВ АЛЬЦГЕЙМЕРА)

Масс-спектрометрия в сочетании с использованием изотопно-меченных стандартов является одним из популярных методов количественного измерения концентрации бета-амилоидов в биологических средах. Данная статья посвящена предупреждению типичных систематических ошибок таких измерений, возникающих вследствие пренебрежения возможностью превращения бета-амилоидов в денатурированную форму, которая дает в масс-спектрах сигналы в 3 раза более интенсивные, чем нативная форма. Степень этой денатурации определялась по способности нативной формы образовывать комплекс с a-2-макроглобулином, чего денатурированная форма лишена. Показано, что денатурация может происходить при нагревании в кислой среде или при использовании диметилсульфоксида в качестве растворителя. Ошибка измерения возникает, когда изотопно-меченный стандарт и аналит относятся к разным формам. Предложены рекомендации для преодоления систематических ошибок количественного анализа этих соединений посредством принудительной денатурации смеси аналита со стандартом перед анализом.

Кл. сл.: количественная масс-спектрометрия, бета-амилоиды, a-2-макроглобулин

Список сокращений:

a2M — a-2-макроглобулин;

Ap — р-амилоидные пептиды (пеп-

тиды Альцгеймера);

Pep-a2M — пептид VGFYESDVMGR, от-

щепляемый от a2M трипсином;

MALDI-MS — масс-спектрометрия матрично-активированной лазерной десорбции / ионизации (matrix-assisted laser desorption / ionization mass spectrometry);

TFA — трифторуксусная кислота;

DMSO — диметилсульфоксид.

ВВЕДЕНИЕ

Количественное определение бета-амилоидов (AP) в биологических пробах имеет важное значение для диагностики болезни Альцгеймера. Одним из важных методов анализа Ap является масс-спектрометрия с изотопно-меченным стандартом Ap ( N или O). Эта статья является предупреждением о возникновении систематических ошибок такого определения в свете открывшихся обстоятельств. А именно, возможности существования Ap в виде двух форм — нативной и денатурированной. Последняя образуется при нагревании Ap в кислой среде или растворении его в DMSO. Причем денатурированная форма дает в масс-

спектрах сигнал в несколько раз (примерно в 3 раза) более интенсивный, чем нативная.

Однако столь значительное изменение интенсивности сигналов в масс-спектре явилось для нас неожиданностью, побудившей предпринять исследование этого феномена. Эта задача представлялась нам тем более важной, что при анализе бета-амилоидов в крови человека в целях диагностики болезни Альцгеймера такая ошибка могла бы привести к ошибочному отнесению патологии к норме.

Принципиальные ошибки измерения концентрации Ар методом количественной масс-спектро-метрии возникают тогда, когда определяемый Ар относится к нативной форме, а его изотопно-меченный стандарт — к денатурированной. Такая ситуация типична, когда анализируемый Ар имеет природное происхождение, а стандарт используется в виде раствора в DMSO (этот растворитель часто применяется для приготовления растворов Ар, поскольку он не летуч и хорошо растворяет Ар в отличие от других растворителей). При этом DMSO действует как денатурирующий агент. Ранее в работе [1] 2015 г. уже отмечалось, что при использовании DMSO в качестве растворителя могут происходить изменения физико-химических свойств пептидов, однако конкретно бета-амилоиды в ней не были упомянуты.

В предыдущей нашей работе [2] было обнаружено, что нативные Ар образуют комплекс с а2М,

вследствие чего тот перестает взаимодействовать с трипсином. Т.е. Aß способны выступать в роли ингибитора этого взаимодействия, тогда как денатурированные Aß теряют такую способность. Это обстоятельство позволяет называть нативную форму Aß активной, а денатурированную — неактивной. Кинетика дезактивации Aß была нами ранее [2] изучена на основании измерения количества фрагмента Pep-a2M, отщепляемого трипсином от человеческого а2М (у мышиного а2М такого отщепления не наблюдается). Метод работы с а2М и трипсином [2] позволил точно определять соотношение активной и неактивной форм Aß в их смеси, а следовательно, и следить за процессом дезактивации Aß в различных условиях. Недостатками указанного метода являются его трудоемкость и нетехнологичность.

МАТЕРИАЛЫ И МЕТОДЫ

Материалы

Пептид VGFYESDVMGR, синтезированный в ООО "НПФ Верта". Трипсин свиной "Promega". DMSO "Sigma-Aldrich". H218O (97% 18O) "Sigma-Aldrich". TFA "Sigma-Aldrich". a-1-антитрипсин "Abcam". Низкомолекулярный ингибитор трипсина PMSF "Sigma-Aldrich". а-циано-4-гидрокси-коричная кислота "Bruker". Деионизированная вода Li Chrosolv "Merck". Пептиды Aß и их 15N-содержащие стандарты фирмы "rPeptide".

a2M выделен из сыворотки крови человека гель-фильтрацией и любезно предоставлен сотрудником ФГБУ "НИИ гриппа им. А.А. Смородин-цева" Арамом Шалджяном.

Масс-спектрометрия

Масс-спектры получены с помощью масс-спектрометра Ultraflex II MALDI-ToF/ToF (Bruker Daltonics, Германия), оборудованного Nd:YAG (Neodymium-doped Yttrium Aluminium Garnet; Nd:Y3Al5O12) лазером.

Пептиды детектировали в виде положительных ионов с использованием в качестве матрицы а-циано-4-гидроксикоричной кислоты (HCCA) (BrukerDaltonics, Германия). Точность измерения моноизотопных масс была не хуже 50 миллионных долей (ppm).

Растворы пептидов Альцгеймера

Все анализируемые пептиды были растворены в буфере, содержащем 20% ацетонитрила и 1% NH4OH. Концентрация пептидов в растворах составляла 23 мкМ. 15^изотопно-меченные стандарты пептидов Альцгеймера были растворены в 100% DMSO. Концентрация составляла 11.5 мкМ.

Получение 18О-изотопно-меченного стандарта пептидов Альцгеймера

Растворы пептидов Альцгеймера в концентрации 23 мкМ смешивались с Н2180, ацетонитрилом и 100% трифторуксусной кислотой в соотношении 1:4:4:1 об. (пептид : Н2180 : ацетонитрил : TFA). Смесь инкубировалась в твердотельном термостате при температуре 50 °С в течение 30 мин для протекания изотопного обмена. После инкубации стандарт оставался в растворе, высушивание не производилось.

Термоактивация пептидов Альцгеймера в TFA

Растворы пептидов Альцгеймера в концентрации 23 мкМ смешивались с водой, ацетонитрилом и 100% трифторуксусной кислотой в соотношении 1:4:4:1 об. (пептид : вода : ацетонитрил : TFA). Смесь инкубировалась в твердотельном термостате "Гном" ("ДНК-Технология", Россия) при температуре 50 °С в течение 30 мин.

Термоактивация в растворе матрицы

Растворы пептидов Альцгеймера в концентрации 23 мкМ смешивались с раствором матрицы (а-циано-4-гидроксикоричной кислотой) в 70% ацетонитриле с 1% TFA и добавлением 10 нМ ок-тил-Р^-глюкопиранозида. Смесь инкубировалась в течение 30 мин при температуре 50 °С.

Термоактивация в буферном растворе

Растворы пептидов Альцгеймера в концентрации 23 мкМ смешивались с буфером, в котором они растворены (20% ацетонитрил, 1% N^0^). Раствор инкубировался в течение 30 мин при температуре 50 °С.

Инкубация пептидов Альцгеймера в DMSO

Исходный раствор пептида в буфере (20% ацетонитрила, 1% N^0^) разбавлялся в 10 раз 100% DMS0. Пептид в DMS0 выдерживался в течение 4, 24 и 48 ч при температуре 23 °С. Часть раствора пептида, выдержанная в течение 24 и 48 ч, подвергалась инкубированию в течение 1 ч при температуре 50 °С.

РЕЗУЛЬТАТЫ ЭКСПЕРИМЕНТА И ИХ ОБСУЖДЕНИЕ

Общее описание

В экспериментах использовался ряд пептидов Альцгеймера. В качестве изотопного стандарта применялись как синтетические их аналоги с изотопом так и аналоги с изотопом 180, получаемые изотопным обменом с тяжелой водой Н2 О.

Табл. 1. Пептиды, использованные в эксперименте (обозначения, аминокислотные последовательности, моноизотопные величины молекулярной массы и отношение интенсивности сигнала в масс-спектре после термообработки в присутствии ТБА к исходному сигналу)

Пептиды Аминокислотная последовательность Мг !терм./о

ЛР(1—21)* DAEFRHDSGYEVHHQKKLVFF 2588.3 1.0

ЛР(1-38) DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAПGLMVGG 4129.0 3.1

ЛР(1-40) DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAПGLMVGG VV 4327.2 3.1

15^ЛР(1-40) 4381.2 1.0

ЛР(1-42) DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAПGLMVGG VVIA 4511.3 2.5

15^ЛР(1-42) 4567.3 1.0

а2М-^тап (705-717) VGFYESDVMGR 1259.7 1.0

Примечание: * — аналог пептида ЛР(1-20)

Помимо этого нами был получен пептидный фрагмент Рер-а2М путем трипсинолиза человеческого а2М. Список использованных пептидов и отдельные характеристики представлены в табл. 1.

Полученный нами стандарт с изотопом 180 не является гомогенным, поскольку представляет собой смесь пептидов с разным числом замещенных атомов кислорода, число которых зависит как от продолжительности обмена с тяжелой водой Н2180, так и от изотопной чистоты самой воды. В нашем случае не требуется, чтобы стандарт был

индивидуальным соединением, а является вполне достаточным, чтобы смесь с разным числом включенных атомов 180 давала в масс-спектре сигналы, не перекрывающиеся с сигналами аналита. В нашем случае статистическое распределение вклада каждого индивидуального компонента в зависимости от числа включенных в его состав атомов 180 приведено на рис. 1. Масс-спектр такого стандарта в смеси с незамещенным пептидом ЛР(1-40) приведен на рис. 2.

Рис. 1. Процентное содержание 180-замещенных компонентов стандарта в зависимости от числа включенных в его состав атомов 180

6 7 а 9 1С 11 12 13 14 15 15 1/ 1В 19 2С 21

Число атомов 180 в молекуле

mIz.

Рис. 2. Изотопное распределение пептида ЛР(1-40) в смеси со стандартом.

а — исходное соотношение; б — соотношение после инкубации пептида в смеси 10% ТБЛ и 40% ацетонит-рила в течение 30 мин при температуре 50 °С

Табл. 2. Оценка влияния инкубации пептида Aß(1-38) в 10% TFA + 40% ацетонитрил при 50 °C на соотношение интенсивностей молекулярных ионов аналита и его стандарта

Проба Инкубация в 10% TFA + 40% ацетонитрил Отношение сумм площадей пептид/стандарт

1 2 30 мин, 50 °C 1.02 2.99

Вместе с тем выяснилось, что при смешивании эквимолярных количеств анализируемого образца и полученного из него стандарта интенсивность стандарта в спектре оказалась примерно в 3 раза выше интенсивности исходного пептида. Однако если анализируемый образец выдержать в условиях, аналогичных получению стандарта, то его интенсивность вырастет (см. рис. 2, б) и их интенсивности станут равными. В этой связи нами было предпринято детальное изучение этого эффекта как имеющего важнейшее значение для количественного анализа этих пептидов.

Изменение интенсивности сигнала пептида АР(1-40) в кислых средах (в присутствии TFA)

Известно, что TFA традиционно используется в составе растворов при приготовлении матриц при масс-спектрометрической детекции пептидов. Кроме того, 10% TFA при повышенной температуре используется для получения 18О-содержащих стандартов пептидов Ар. В то время как при получении 8О-содержащего стандарта применяются исключительно жесткие условия — высокая концентрация TFA и повышенная температура. Вместе с тем использование TFA при работе с пептидами

часто необходимо при масс-спектрометрической детекции (в наших экспериментах около 9% TFA в составе растворителя для матриц). В связи с этим представляло интерес оценить возможность предподготовки проб с использованием достаточной концентрации TFA и в том числе использовать непосредственно предподготовку образцов в матрице при одномоментном присутствии как анализируемого образца, так и его стандарта.

Температурное воздействие на пептид ЛР(1-40), находящийся в кислой среде, привело к увеличению интенсивности иона пептида относительно стандарта в 2.5 раза (см. табл. 2).

Специальными экспериментами было показано, что одинаковое возрастание интенсивности всех используемых пептидов достигается, начиная с использования 1-2% TFA при инкубации при 50 °С в течение 30 мин для всех образцов, и достигает тех же значений при инкубации в растворе матриц. При этом, как показали дополнительные эксперименты с пептидом, представленные на рис. 3, для достижения аналогичного эффекта увеличения интенсивности можно при этой же температуре

ограничиться добавлением TFA в концентрации 1-2%.

Таким образом, при использовании полученного путем изотопного обмена стандарта пептида для получения корректных данных количественного анализа пептидов имеются два пути: либо ввести коэффициент пропорциональности, либо перед масс-спектрометрической детекцией провести термообработку анализируемого образца.

Из полученных результатов два вывода. Первый заключается в том, что интенсивность пептидов при масс-спектрометрической детекции зависит от предобработки анализируемых образцов. В частности, увеличение интенсивности при тер-мостатировании при 50 °С в течение 30 мин в присутствии TFA с концентрацией более 1%. Учитывая, что в состав матрицы входит 7%-я TFA, представляется целесообразным просто термостатировать образец в этом растворе в течение 30 мин. Экспериментально показано, что в этих условиях достигается максимальное увеличение интенсивности, близкое к 3.0.

3.5

2.5

1.5

-И # ¿Р'Ц ^тт. л • 1 • • •« —

Г" / / / /

/ !•

ТРА

—•--596

2% • 0.50% --•—0%

10

20

30

40

50

60

70

Продолжительность инкубации, мин

Рис. 3. Изменение в интенсивности при масс-спектрометрическом анализе пептида ЛР(1-38) относительно его стандарта после инкубации пептида в TFA.

По вертикальной оси отложено отношение интенсивности после инкубации к начальной интенсивности

Рис. 4. Способность пептида ЛР(1-40) к ингибированию взаимодействия а2М с трипсином при термо-статировании пептида при 50 °С.

■ — активность ингибирования а2М; А — изменение масс-спектрометрической интенсивности иона пептида ЛР(1-40) при термостатировании

100 *

V© 0х я" 50 Е & 80

51 м 70 а с | 60 ГО 1- Ё £ 50 (V О с :> го з 40 х го О т й

iНе можете найти то, что вам нужно? Попробуйте сервис подбора литературы.

Интенсивность И1 Ингибирование в Н* Ш О О О О _ Ь.1

) 20 40 60 80 100 120 14 Время, мин

Влияние термообработки пептида на активность ЛР(1-40)

В представленном следующем эксперименте проведена термообработка пептида ЛР(1-40) и его триптического гидролизата при 50 оС. Повышение температуры было выбрано из необходимости ускорения процесса, поскольку даже при 50 °С время полуинактивации пептида ЛР(1-40) составляет примерно 24 ч. В связи с этим предстояло оценить устойчивость этого пептида при термообработке при 50 °С в отсутствие DMSO. Результаты этого эксперимента при инкубации пептида при 50 °С представлены на рис. 4.

Из полученных данных следует: при масс-спек-трометрической детекции при полном сохранении активности быстро возрастает интенсивность сигнала по отношению к стандарту (растворенному в DMSO), внесенному после термоактивации уже в матрицу (см. Материалы и методы). Этот факт необходимо учитывать при использовании масс-спектрометрии для количественного определения концентраций этих пептидов с использованием изотоп-содержащих стандартов (в представленном выше случае ошибка в определении может составлять порядка 300%).

Влияние термообработки на смесь пептидов ЛР(1-38), ЛР(1-40) и ЛР(1-42)

В тех же условиях была подвергнута термообработке смесь всех трех имеющихся пептидов Р-амилоида — Лр(1-38), Лр(1-40) и Лр(1-42) — в надежде, что инкубация смеси этих пептидов в кислой среде позволит выровнять детектируемые интенсивности. Однако на деле соотношение интенсивностей пептидов осталось тем же. Тем не менее детектируемость пептидов от этой операции все же улучшилась, что особенно ценно в отношении пептида ЛР(1-42), интенсивность иона которого обычно мала.

В сравнении со стандартом каждый из пептидов показал одинаковое увеличение интенсивности (табл. 3).

Изменение активности пептида ЛР(1-40) при инкубации в DMSO

DMSO — часто используемый растворитель для гидрофобных пептидов, в том числе и для растворения пептидов Альцгеймера. Именно этот растворитель был использован нами для приготовления растворов ^-стандарта.

Табл. 3. Изменения в соотношении интенсивностей пептидов Лр по отношению к стандарту 180 - ЛР(1-40)

Соотношение сумм площадей пептид / стандарт до инкубации Соотношение сумм площадей

Пептид пептид / стандарт после инкубации

ЛР(1-38) 1.83 3.63

ЛР(1-40) 0.38 0.70

ЛР(1-42) 0.04 0.08

Экспериментально выяснилось, что стандарты пептидов не обладают способностью ингибиро-вать а2М. В связи с этим нами была проведена проверка влияние DMS0 на активность пептида ЛР(1-40). Для этого пептид ЛР(1-40) из буферного раствора (20% ацетонитрил, 1% аммиак) разбавлялся в 10 раз 100%-м DMS0. Пептид с DMS0 выдерживался в течение 4, 24 и 48 ч. После этого часть пробы подвергалась дополнительному инкубированию в течение 1 ч при температуре 50 °С.

В качестве контроля количества а2M в сыворотке была подготовлена проба из сыворотки без добавления пептида ЛР(1-40). Вместо пептида добавлялся бикарбонатный буфер. В качестве контроля за протеканием ингибирования была приготовлена проба из сыворотки с добавлением пептида без DMS0. Результаты измерения активности a2M после инкубации с ЛР(1-40), предварительно выдержанным в DMS0, представлены на рис. 4. Как следует из представленных данных, ингиби-рующая способности пептида ЛР(1-40) существенно снижается со временем и в конечном итоге получается полностью неактивный пептид, что и наблюдается у стандартов, растворенных в DMS0.

Полученные результаты указывают на то, что инкубация пептидов Альцгеймера с DMS0 приводит к утрате способности ингибировать взаимодействие a2M с трипсином. Нагревание при этом

не оказывает существенного влияния. Подобный результат, возможно, объясняется изменением пространственной структуры пептида. Это согласуется с результатами, ранее полученными при инкубации сыворотки с ^изотопно-меченными стандартами пептидов Лр, которые, будучи растворенными в 100% DMS0, не обладали ингиби-рующей способностью. Это не противоречит данным по термоактивации пептидов, которая не приводила к утрате ингибирующей способности, но приводила к увеличению интенсивности при масс-спектрометрической детекции.

Показано, что Лр при выдерживании в растворе DMS0 теряет способность связываться с a2M и, соответственно, ингибировать его способность к взаимодействию с протеазами на примере трипсина. Скорость инактивации зависит от концентрации DMS0. Это, в свою очередь, позволило по взаимодействию с a2M предложить метод, дающий количественную оценку содержания пептидов Лр, способных (активных) или теряющих способность (неактивных) ингибировать a2M.

В качестве примера использования этого подхода на рис. 5 представлен процесс потери инги-бирующей способности по отношению к a2M для пептида Лр(1-38) в растворе, содержащем 20% DMS0.

Рис. 5. Кинетика ингибирования пептида ЛР(1-38) в 20% DMS0

Тот факт, что DMSO дезактивирует возможность Ар связываться с а2М, позволяет предположить, что такой Ар теряет способность взаимодействия с теми рецепторами, с которыми он взаимодействует в организме больного. Об этом косвенно свидетельствует и то, что DMSO может служить полезным адъювантом для противодействия Лр-опосредованной синаптотоксичности [3].

Зависимость масс-спектрометрической детекции пептида ЛР(1-38) от его активности

Влияние состояния пептида ЛР(1-38) на его масс-спектрометрическую детекцию проверялось относительно 15К-стандарта этого пептида. Стандарт растворен в 100% DMSO, и его интенсивность стабильна независимо от проводимых с ним манипуляций.

Небольшой объем каждого из образцов пептида, инактивированного в DMSO, смешивался с равным объемом стандарта и анализировался масс-спектрометрически. В качестве контроля максимального изменения интенсивности был взят не подвергавшийся инкубации в DMSO пептид, который инкубировался в 2.5% TFA (равные объемы раствора пептида и 5% TFA) в течение 30 мин при температуре 50 оС. Все образцы, инкубированные в DMSO, также смешивались с TFA для оцен-

ки изменения интенсивности вследствие действия TFA. Для каждого образца было сделано 3 повторных измерения.

У не подвергавшихся действию DMSO образцов наблюдалось увеличение интенсивности в 3 раза относительно неинкубированных в TFA. При этом образцы после воздействия DMSO показали четкую зависимость в изменении интенсивности ионов в зависимости от активности этих пептидов (рис. 6).

Эта зависимость позволяет оценить активность пептида Лp по интенсивности его сигнала в масс-спектрометре. Для этого достаточно получить масс-спектры образца относительно стандарта без инкубации в TFA и после инкубации. После инкубации в TFA достигается максимальная интенсивность, соответствующая троекратной интенсивности по сравнению с активным пептидом Лp. Если пептид был частично неактивен, то изменение интенсивности после инкубации в TFA будет меньше 3. В последнем случае делением на 3 изменения интенсивности мы получим активность исследуемого пептида. Например, если после инкубации с TFA изменение интенсивности составило 1.8 раза, то на графике необходимо отложить значение по оси изменения интенсивности 3/1.8 = = 1.67, что соответствует активности 60%.

Рис. 6. Зависимость интенсивности масс-спектрометрической детекции пептида Aß(1-38) от активности пептида

ЗАКЛЮЧЕНИЕ

Из нашего исследования логически вытекает рекомендация: перед анализом прогревать смесь аналита Ар со стандартом в присутствии 0.5% TFA, что ведет к денатурации обоих компонентов смеси. Этим способом достигается единообразие их форм, заодно повышая интенсивность их сигналов в масс-спектре.

При анализе необходимо учитывать различную интенсивность сигналов от АР(1-38), АР(1-40) и АР(1-42) — в этом ряду она убывает. Что не позволяет количественно измерить всех их с помощью одного изотопно-меченного стандарта.

СПИСОК ЛИТЕРАТУРЫ

1. Laurents D.V., Pantoja-Uceda D., Lopez C., Carrode-guas A., Mompean M., Jimenez M.A., Sancho J. DMSO affects AP(1-40)' s conformation and interactions with aggregation inhibitors as revealed by NMR // Rsc Advances. 2015. Vol. 5, is. 85, P. 69761-69764. DOI: 10.1039/C5RA12100K

2. Protasov A.V., Mirgorodskaya O.A., Kozmin Y.P., Go-bom J. A mass spectrometric approach to study the interaction of amyloid p peptides with human a-2-macroglobulin // Biochimie. 2021. Vol. 191. P. 62-68. DOI: 10.1016/j.biochi.2021.08.008

3. Penazzi L., Lorengel J., Sundermann F., Golovyashki-na N., Marre S., Mathis C.M.B., Lewejohann L., Brandt R., Bakota L. DMSO modulates CNS function in a preclinical Alzheimer's disease model // Neuropharmacology. 2017. Vol. 113, Part A. P. 434-444. DOI: 10.1016/j.neuropharm.2016.10.020

ФГБУ Научно-исследовательский институт гриппа им. А.А. Смородинцева Минздрава России, Санкт-Петербург, Россия (Миргородская О.А., Протасов А.В.)

Институт биоорганической химии им. академиков М.М. Шемякина и Ю.А. Овчинникова РАН, Москва, Россия (Козьмин Ю.П.)

Институт аналитического приборостроения РАН, Санкт-Петербург, Россия (Бубляев P.А.)

Кафедра психиатрии и нейрохимии Института неврологии и физиологии Сальгренской академии Гетеборгского университета, Швеция (Гобом Й.)

Лаборатория клинической нейрохимии, Университетская клиника Сальгренска, Молндаль, Швеция (Гобом Й.)

Контакты: Бубляев Ростислав Анатольевич, bub-slava@yandex.ru

Материал поступил в редакцию 27.08.2022

ISSN 0868-5886

NAUCHNOE PRIBOROSTROENIE, 2022, Vol. 32, No. 4, pp. 35-48

FEATURES OF MASS SPECTROMETRIC DETECTION BETA-AMYLOID PEPTIDES (ALZHEIMER'S PEPTIDES)

O. A. Mirgorodskaya1, A. V. Protasov1, Yu. P. Kozmin2, R. A. Bublyaev3, J. Gobom4

1 Smorodintsev Research Institute of Influenza of Ministry of Health of the Russian Federation,

Saint Petersburg, Russia 2Shemyakin and Ovchinnikov Institute of Bioorganic Chemistry RAS, Moscow, Russia 3Institute for Analytical Instrumentation of RAS, Saint Petersburg, Russia 4 University of Gothenburg, Göteborg, Vaestra Goetaland, Sweden

Mass spectrometry combined with the use of isotope-labeled standards is one of the favored methods for the quantitative measurement of beta-amyloid concentrations in biological media. This article is devoted to the prevention of typical systematic errors in such measurements arising from the neglect of the possibility of beta-amyloid transformation into the denatured form, which gives in mass spectra signals three times more intensity than the native form. The degree of this denaturation was determined by the ability of the native form to set up a complex with a-2-macroglobulin. The denatured form lacks this point. It was shown that denaturation can occur in the case of heat treatment in an acidic environment or when DMSO is used as a solvent. Measurement error occurs when the isotope-labeled standard and the analyte are of different forms. There are suggested recommendations to overcome systematic errors in the quantitative analysis of these compounds by forcing denaturation of the mixture of the analyte with the standard before analysis.

Keywords: quantitative mass spectrometry, beta-amyloids, a-2-macroglobulin

List of abbreviations:

a2M — a-2-macroglobulin;

Ap — p-amyloid peptides (Alzhei-

mer's peptides);

Pep-a2M — peptide VGFYESDVMGR,

cleaved from a2M by trypsin;

MALDI-MS — matrix-assisted laser desorp-tion/ionization mass spectrometry;

TFA — trifluoroacetic acid;

DMSO — dimethyl sulfoxide.

INTRODUCTION

The quantification of beta-amyloids (Ap) in biological samples is critical for Alzheimer's disease diagnosis. One important method of Ap analysis is iso-topically labeled Ap (15N or O) mass spectrometry. This article is a warning of the occurrence of systematic errors in such a definition in light of the circumstances that have emerged. Namely, the possibilities of existence Ap in two forms: native and denatured. The latter is formed by heating the Ap in an acidic medium or dissolving it in DMSO. Moreover, the denatured form in the mass spectra gives a signal several times (about 3 times) more intense than the native form.

However, such a significant change in the intensity of signals in the mass spectrum came as a surprise to us, prompting us to undertake research on this phenomenon. This task seemed all the more important to us because, when analyzing beta-amyloids in human blood for the purpose of diagnosing Alzheimer's disease, such an error could lead to an erroneous attribution of pathology to the norm.

The primary errors in quantitative mass spectrome-try Ap concentration measurement occur when the Ap to be determined is native, and its isotopically labeled standard is denatured. This situation is typical when the Ap to be analyzed is of natural origin and the standard is used as a solution in DMSO (this solvent is often used to prepare Ap solutions, since it is not volatile and dissolves Ap well, unlike other solvents). DMSO acts as a denaturing agent. Earlier in 2015 [1], it was already noted that when using DMSO as a solvent, changes in the physicochemical properties of peptides can occur, but beta-amyloids were not specifically mentioned in it.

In our previous work [2], it was found that native Aps form a complex with a2M, as a result of which it ceases to interact with trypsin. I.e., Aps are able to act as an inhibitor of this interaction, while denatured Ap lose such an ability. This circumstance allows you to call the native form of Ap active, and the denatured one — inactive. The kinetics of Ap decontamination have been studied by us previously [2] based on the measurement of the amount of Pep-a2M fragment

cleaved from the human a2M by trypsin (no such cleavage is observed in mouse a2M). The method of working with a2M and trypsin [2] made it possible to accurately determine the ratio of the active and inactive forms of Ap in their mixture, and therefore to monitor the decontamination process of the Ap under various conditions. The disadvantages of this method are its labor intensity and low technology.

MATERIALS AND METHODS Materials

VGFYESDVMGR peptide synthesized by NPF Verta LLC. Porcine trypsin Promega. DMSO Sigma-Aldrich. H218O (97% l8O) Sigma-Aldrich. TFA Sig-ma-Aldrich. a-l-antitrypsin Abcam. Low molecular weight inhibitor of trypsin PMSF Sigma-Aldrich. a-cyano-4-hydroxycoric acid Bruker. Deionized water Li Chrosolv Merck. Ap peptides and their 15N-containing rPeptide standards.

a2M was isolated from human blood serum by gel filtration and was kindly provided by Aram Shaldzhyan, an employee of the A.A. Smorodintsev Research Institute of Influenza.

Mass-spectrometry

Mass spectra were obtained using an Ultraflex II MALDI-ToF/ToF mass spectrometer (Bruker Dalton-ics, Germany) equipped with a laser Nd: YAG (Neo-dymium-doped Yttrium Aluminum Garnet; Nd:Y3Al5O12).

Peptides were detected as positive ions using a-cyano-4-hydroxycoric acid (HCCA) (BrukerDalton-ics, Germany) as a matrix. The accuracy of measurement of monoisotopic masses was no worse than 50 ppm.

Solutions of Alzheimer's peptides

All analyzed peptides were dissolved in a buffer containing 20% acetonitrile and 1% NH4OH. The concentration of peptides in the solutions was 23 ^M. 15N-isotopically labeled Alzheimer's peptide standards have been dissolved in 100% DMSO. The concentration was 11.5 ^M.

Preparation of an 18O-isotopically labeled standard of Alzheimer's peptides

Solutions of Alzheimer's peptides at a concentration of 23 ^M were mixed with H218O, acetonitrile and 100% trifluoroacetic acid in a ratio of 1:4:4:1 vol. (peptide : H218O : acetonitrile : TFA). For isotope exchange, the mixture was incubated in a solid state thermostat at 50 °C for 30 min. After incubation, the standard remained in solution and no drying was performed.

Thermal activation of Alzheimer's peptides in TFA

Solutions of Alzheimer's peptides at a concentration of 23 ^M were mixed with water, acetonitrile, and 100% trifluoroacetic acid in a ratio of 1:4:4:1 vol. (peptide : water : acetonitrile : TFA). The mixture was incubated in a Gnome solid state oven (DNK Technology, Russia) at 50 °C for 30 min.

Thermal activation in matrix solution

Solutions of Alzheimer's peptides at a concentration of 23 ^M were mixed with the matrix solution (a-cyano-4-hydroxycoric acid) in 70% acetonitrile with 1% TFA and the addition of 10 nM octyl-p-D-glucopyranoside. Mix was incubated at 50 °C for 30 min.

Thermal activation in buffer solution

Solutions of Alzheimer's peptides at a concentration of 23 ^M were mixed with the buffer in which they were dissolved (20% acetonitrile, 1% NH4OH). The solution was incubated at 50 °C for 30 min.

Incubation of Alzheimer's peptides in DMSO

The stock solution of peptide in buffer (20% ace-tonitrile, 1% NH4OH) was diluted 10-fold with 100% DMSO. The peptide in DMSO was aged for 4, 24 and 48 h at 23 °C. A portion of the peptide solution aged for 24 and 48 h was incubated at 50 °C for 1 h.

RESULTS OF THE EXPERIMENT AND THEIR DISCUSSION

General description

Experiments have used a number of Alzheimer's peptides. As an isotope standard, both their synthetic analogues with the isotope 15N and analogues with the isotope 18O obtained by isotope exchange with heavy water H218O were used.

In addition, we obtained a Pep-a2M peptide fragment by trypsinolysis of human a2M. The list of pep-tides used and the individual characteristics are shown in Tab. 1.

Tab. 1. Peptides used in the experiment (designations, amino acid sequences, monoisotope values of molecular weight and ratio of signal intensity in the mass spectrum after heat treatment in the presence of TFA to the original signal)

The standard we obtained with the isotope 18O is not homogeneous, since it is a mixture of peptides

with different numbers of substituted oxygen atoms, the number of which depends both on the duration of exchange with heavy water H218O and on the isotopic purity of water itself. In our case, it is not necessary that the standard be an individual compound but quite sufficient for a mixture with varying numbers of included 18O atoms to produce signals in the mass spectrum that do not overlap with those of the analyte. In our case, the statistical distribution of the contribution of each individual component, depending on the number of 18O atoms included in its composition, is shown in Fig. 1. The mass spectrum of such a standard mixed with the unsubstituted Ap (1-40) peptide is shown in Fig. 2.

Fig. 1. Percentage of 18O-substituted components of the standard depending on the number of 8O atoms included in its composition

Fig. 2. Isotopic distribution of Ap(1-40) peptide in a mixture with standard.

a — initial ratio; 6 — the ratio after incubation of the peptide in a mixture of 10% TFA and 40% acetoni-trile at 50 °C for 30 min

At the same time, it turned out that when mixing equimolar amounts of the analyzed sample with the standard obtained from it, the intensity of the standard in the spectrum was about 3 times higher than the intensity of the original peptide. However, if the analyzed sample is held under conditions analogous to those used for the preparation of the standard, then its intensity will increase (see Fig. 2, 6) and their intensities will become equal. In this regard, we have undertaken a detailed study of this effect, which is crucial for the quantitative analysis of these peptides.

Change in AP(1-40) peptide signal intensity in acidic media (in the presence of TFA)

TFA is known to be traditionally used in the composition of solutions when preparing matrices during mass spectrometric detection of peptides. In addition, 10% TFA at an elevated temperature is used to produce 18O-containing Ap peptide standards. During the preparation of the 8O-containing standard, extremely stringent conditions are applied — a high concentration of TFA and an elevated temperature. However, when working with peptides, the use of TFA is often necessary for mass spectrometric detection (in our experiments, about 9% TFA was used as a solvent for the matrices). In connection with this, it was of interest to evaluate the possibility of pre-preparing samples using a sufficient concentration of TFA and, among

other things, to directly pre-prepare samples in the matrix in the simultaneous presence of both the analysed sample and its standard.

iНе можете найти то, что вам нужно? Попробуйте сервис подбора литературы.

Temperature exposure of the Ap(1-40) peptide in an acidic medium resulted in a 2.5-fold increase in the intensity of the peptide ion relative to the standard (see Tab. 2).

Tab. 2. Evaluation of the effect of incubation of Aß(1-38) peptide in 10% TFA + 40% acetonitrile at 50 °C on ratio of intensities of molecular ions of analyte and its standard

Special experiments have shown that the same increase in intensity of all peptides used is achieved by starting with 1-2% TFA in incubation at 50 °C for 30 min for all samples, and reaches the same values when incubated in matrix solution. At the same time, as shown by additional experiments with the peptide (see Fig. 3), one may confine himself to adding TFA at the same temperature and a concentration of 1-2% in order to achieve a similar effect of increasing the intensity.

Fig. 3. Change in intensity in the mass spectrometric analysis of Ap(1-38) peptide with respect to its standard after incubation of the peptide in TFA. The vertical axis is the ratio of post-incubation intensity to initial intensity

Thus, when using the peptide standard obtained by isotope exchange, there are two ways to get correct data for quantitative analysis of peptides: either introduce a proportionality coefficient, or conduct a mass spectrometric detection after heat treatment of the analysed sample.

Two conclusions are drawn from the results obtained. The first is that the intensity of the peptides during mass spectrometric detection depends on the pretreatment of the analyzed samples. In particular, an increase in intensity during thermostating at 50 °C for 30 min in the presence of TFA with a concentration of more than 1%. Considering that the matrix contains 7% TFA, it seems advisable to simply thermostat the sample in this solution for 30 min. It has been experimentally shown that under these conditions, the maximum increase in intensity of close to 3.0 is achieved.

Effect of peptide heat treatment on AP(1-40) activity

In the following experiment presented, the Ap(1-40) peptide and its tryptic hydrolysate were heat treated at 50 °C. The increase in temperature was cho-

sen because of the need to accelerate the process, since, even at 50 °C, the time for half-inactivation of the Ap(1-40) peptide is about 24 h. Therefore, it was necessary to evaluate the stability of this peptide upon heat treatment at 50 °C in the absence of DMSO. The results of this experiment when incubating the peptide at 50 °C are shown in Fig. 4.

Fig. 4. The ability of AP(1-40) peptide to inhibit the interaction of a2M with trypsin by thermostating the peptide at 50 °C.

■ — a2M inhibition activity; A — change in mass spectrometric intensity of AP(1-40) peptide ion during thermostating

It follows from the obtained data that during mass spectrometric detection, with complete preservation of activity, the signal intensity rapidly increases in relation to the standard (dissolved in DMSO) introduced into the matrix after thermal activation (see Materials and methods). This fact must be taken into account when using mass spectrometry to quantify the concentrations of these peptides using isotope-containing standards (in the above case, the error in determination can be in the order of 300%).

Effect of heat treatment on the mixture of Ap(1-38), Ap(1-40) and Ap(1-42) peptides

Under the same conditions, a mixture of all three available p-amyloid peptides — Ap(1-38), Ap(1-40) and Ap(1-42) — was heat treated, in the hopes that incubation of a mixture of these peptides in an acidic environment would allow equalization of the detected intensities. However, in fact, the ratio of peptide intensities remained the same. Nevertheless, the detec-tability of peptides after this operation still improved, which is especially valuable with respect to the Ap(1-42) peptide, whose ion intensity is usually low.

In comparison with the standard, each of the pep-tides showed the same increase in intensity (Tab. 3).

Tab. 3. Changes in the ratio of Ap peptides to standard 18O- Ap(1-40)

Change in Ap(1-40) peptide activity during incubation in DMSO

DMSO is a frequently used solvent for hydrophob-ic peptides, including Alzheimer's peptides. It was this solvent that we used to prepare solutions of the 15N standard.

It has been experimentally found that peptide standards do not have the ability to inhibit a2M. In this regard, we tested the effect of DMSO on the activity

of the Ap(1-40) peptide. To this end, the Ap(1-40) peptide from the buffer solution (20% acetonitrile, 1% ammonia) was diluted 10-fold with 100% DMSO. The peptide with DMSO was kept for 4, 24 and 48 h. After that, part of the sample was further incubated for 1 h at 50 °C.

As a control for the amount of a2M in serum, a sample was prepared from serum without adding Ap(1-40) peptide. A bicarbonate buffer was added instead of the peptide. As a control over the course of inhibition, a serum sample was prepared with the addition of a peptide without DMSO. The results of measuring a2M activity after incubation with Ap(1-40) pretreated in DMSO are shown in Fig. 4. As follows from the presented data, the inhibitory abilities of the Ap(1-40) peptide are significantly reduced over time, and ultimately a completely inactive peptide is obtained, which is observed in standards dissolved in DMSO.

The results indicate that incubation of Alzheimer's peptides with DMSO results in a loss of ability to inhibit a2M interaction with trypsin. Heating does not have a significant effect. This result may be explained by a change in the spatial structure of the peptide. This is consistent with the results previously obtained by incubating serum with 15N-isotopically labeled Ap peptide standards, which, when dissolved in 100% DMSO, had no inhibitory capacity. This does not contradict the data on the thermal activation of peptides, which did not lead to the loss of inhibitory ability, but resulted in increased intensity during mass spectrome-tric detection.

It has been shown that Ap loses the ability to bind to a2M, when kept in a DMSO solution, and, accordingly, inhibits its ability to interact with proteases, as shown by the example of trypsin. The rate of inactiva-tion depends on the concentration of DMSO. This, in turn, made it possible, on the basis of interaction with a2M, to propose a method that quantifies the content of Ap peptides capable (active) or losing the ability (inactive) to inhibit a2M.

As an example of this approach, Fig. 5 shows the process of loss of inhibitory capacity with respect to a2M for the Ap(1-38) peptide in a solution containing 20% DMSO.

Fig. 5. Kinetics of inhibition of Ap(1-38) peptide in 20% DMSO

The fact that DMSO deactivates the ability of Ap to bind to a2M suggests that such Ap loses the ability to interact with those receptors with which it interacts in the patient's body. This is indirectly evidenced by the fact that DMSO can serve as a useful adjuvant to counteract Ap-mediated synaptotoxicity [3].

Dependence of mass spectrometric detection of AP(1-38) peptide on its activity

The effect of the state of Ap(1-38) peptide on its mass spectrometric detection was checked against the 15N standard of this peptide. The standard is dissolved in 100% DMSO and its intensity is stable regardless of handling.

A small volume of each of the DMSO inactivated peptide samples was mixed with an equal volume of the standard and analyzed mass spectrometrically. As a control for the maximum change in intensity, a pep-tide not incubated in DMSO was taken and incubated in 2.5% TFA (equal volumes of peptide solution and 5% TFA) for 30 min at 50 °C. All samples incubated in DMSO were also mixed with TFA to assess the change in intensity due to the action of TFA. For each sample, 3 repeated measurements were made.

Samples not exposed to DMSO showed a 3-fold increase in intensity relative to those not incubated in TFA. At the same time, samples after exposure to DMSO showed a clear dependence in the change in the intensity of ions on the activity of these peptides (Fig. 6).

Fig. 6. Dependence of Ap(1-38) peptide mass spec-trometric detection intensity on peptide activity

This dependence makes it possible to assess the activity of the Ap peptide by its signal intensity in a mass spectrometer. To do this, it is enough to obtain the mass spectra of the sample relative to the standard without incubation in TFA and after incubation. After incubation in TFA, the maximum intensity is achieved, corresponding to three times the intensity compared to the active Ap peptide. If the peptide was partially inactive, then the change in intensity after incubation in TFA would be less than 3. In the latter case, by dividing the changes in intensity by 3, we get the activity of the test peptide. For example, if, after

Contacts: Bublvaev Rostislav Anatol'evich, bub-slava@yandex.ru

incubation with TFA, the intensity change was 1.8 fold, on the graph it is necessary to plot the value along the intensity change axis 3/1.8 = 1.67, which corresponds to 60% activity.

CONCLUSION

The following recommendation logically follows from our study: before the analysis, warm the analyte mixture of Ap with the standard in the presence of 0.5% TFA, which leads to denaturation of both components of the mixture. In this way, the uniformity of their forms is achieved. At the same time, the intensity of their signals in the mass spectrum is increasing.

When analyzing, the various intensities of signals from Ap(1-38), Ap(1-40) and Ap(1-42) — they decrease in this series — must be considered. This does not allow quantitative measurement of all of them using one isotope-labeled standard.

REFERENCES

1. Laurents D.V., Pantoja-Uceda D., Lopez C., Carrode-guas A., Mompean M., Jimenez M.A., Sancho J. DMSO affects Ap(1-40)' s conformation and interactions with aggregation inhibitors as revealed by NMR. Rsc Advances, 2015, vol. 5, is. 85, pp. 69761-69764. DOI: 10.1039/C5RA12100K

2. Protasov A.V., Mirgorodskaya O.A., Kozmin Y.P., Go-bom J. A mass spectrometric approach to study the interaction of amyloid p peptides with human a-2-macroglobulin. Biochimie, 2021, vol. 191, pp. 62-68. DOI: 10.1016/j.biochi.2021.08.008

3. Penazzi L., Lorengel J., Sundermann F., Golovyashki-na N., Marre S., Mathis C.M.B., Lewejohann L., Brandt R., Bakota L. DMSO modulates CNS function in a preclinical Alzheimer's disease model. Neuropharmacology, 2017, vol. 113, part A, pp. 434-444. DOI: 10.1016/j.neuropharm.2016.10.020

Article received by the editorial office on 27.08.2022

i Надоели баннеры? Вы всегда можете отключить рекламу.